HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0285COG1340arCOG01159Uncharacterized archaeal coiled-coil proteincoiled coil protein

HOG Organism Gene ID Name Annotation
cHOG0285 nrc1 VNG0394 ucc coiled coil protein
cHOG0285 hmu HMUK3079 Hmuk_3079 conserved hypothetical protein( EC:3.1.3.3 )
cHOG0285 hma RRNAC1820 hypothetical protein
cHOG0285 hwa HQ1530A hypothetical protein
cHOG0285 hla HLAC0452 Hlac_452 hypothetical protein
cHOG0285 hbo HBOR23410 Hbor_23410 uncharacterized coiled-coil protein( EC:3.1.3.3 )
cHOG0285 hut HUTA2705 Huta_2705 conserved hypothetical protein
cHOG0285 hvo HVO_0880 HVO_0880 coiled-coil protein of COG 1340
cHOG0285 nph NP4058A hypothetical protein
cHOG0285 hhi 2345 HAH_2345 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


394|chp|nrc1      ------MAEEETTIEVSTADEL-ITDDELQNKSKGQLIKNAGQFRDRRNELNQLASSRAS
23410|hp|hbo      MVTQQDVLKEYDVQKLSDADNVELTDDQLDSGSKGQLIKLAGQLRDRRNDLNQMASERAS
1530|hp|hwa       MVTKNSVVETHDVESLKESDNISLTDSKLDNGSKGQLIKVAGQLRDRRNDLNQMASERAS
452|hp|hla        MVTKEEVIEQYDIEAMDEADNVDLSEDDLENGSKGQLIKRAGQLRDRRNELNQMASERAS
2705|chp|hut      -----------MTDSIEESKNVSVTDEDLETKSKGELIKLAGQLRDRRNDLNQMASERAS
4058|hp|nph       -----------MAESIDETDNVELTEDDLENKSKGQLIKLAGQLRDRRNELNQMASERAS
11820|hp|hma      -----------MADSIDESKNVTVTEEDLENKSKGELIKLAGQLRDRRNELNQMASERAS
2345|hp|hhi       -----------MADSIDESKNVTVTEEDLENKSKGELIKLAGQLRDRRNELNQMASERAS
                                 :. :.:: :::..*:. ***:*** ***:*****:***:**.***

394|chp|nrc1      ERDDLNAKTREKVDEAQEHREKRDELNERVQEHKEIRNDLNADANELFDEVEQRKEDLEL
23410|hp|hbo      KRDDLNAKTREKVDEAQEHREQRDSLNEQVQEHKNKRNELNAEANELFDKVEQMKEDLEL
1530|hp|hwa       LRDELNAKTREKVDEAQKHREKRDELNEQVQEHKDKRNELNAEANELFDQVEEMKAELEL
452|hp|hla        NRDDLNAKTREKVDEAQEHREKRDELNEQVQEHKDKRNELNADANELFDEVEELKQDMEL
2705|chp|hut      QRDDLNAKTREKVDEAQEHREKRDELNEQVQEHKEKRNELNAEANELFEQVEDKKEEMEL
4058|hp|nph       ERDDLNAKTREKVDEAQEHREKRDELNEQVQEHKEKRNELNAKANELFDKVDDLKADLEL
11820|hp|hma      ARDDLNAKTREKVDEAQEHREKRDELNEQVQEHKDQRNELNAEANELFDKVDNLKNDLEL
2345|hp|hhi       ARDDLNAKTREKVDEAQEHREKRDELNEQVQEHKDQRNELNAEANELFDKVDNLKNDLEL
                   **:*************:***:**.***.*****: **:***.*****::*:: * ::**

394|chp|nrc1      DEGKDLEQLKEEIEELEFKQQTEVLSTEDERELIEKIEGKREEYQDREEKLDQSGDLEGL
23410|hp|hbo      DDGKDIEELKEEIEQLEFRQQTEVLSTEDERELIEKIENKREELRQKKDKVEDSGELEEL
1530|hp|hwa       DEGKNIEELEDEIEQLEFRQQTEVLSSEDERELIEKIEDKREQLQQKKQKVEDSGELDSL
452|hp|hla        GSGKSIEELKEEIEDLEFRQQTEVLDAEDERELIEKIDEKREKLAEKKEKVDDTSELDEL
2705|chp|hut      DEGKSVDQLEDEIEDLEFKQQTEVLSSEDEQELIEKIEQKREKLAERKEKLEQTDDIDEI
4058|hp|nph       DEGKSIDQLEEEIEDLEFKQQTEVLSSEDERELIEKIEEKREKLSERKEKLDQGGELEEL
11820|hp|hma      DEGTSVEQLKEEIEDLEFKQQTEVLSSEDEKELIEKIETKREKLQEKQEKLDQGGDLEEL
2345|hp|hhi       DEGTSVEQLKEEIEDLEFKQQTEVLSSEDEKELIEKIETKREKLQEKQEKLDQGGDLEEL
                  ..*..:::*::***:***.******.:***.******: ***:  :.::*::: .::: :

394|chp|nrc1      VEEAESVRAEASKHHEKVTELADKAQEHHNQMIEAYREADDIRDEADEMHEDFVEAQEAA
23410|hp|hbo      IEEAEEVRSEASQHHQKVTELADKAQEHHNQMIEAYREADDIRDKADAMHELFVEAQEAA
1530|hp|hwa       KEQAEEVRSEASQHHQKVTELADNAQEHHNQMIEAYREADDIRDEADAMHELFVEAQETA
452|hp|hla        VEEAEEVRSEASQHHQKVTELADKAQEHHNQMIEAYREADDIRDEADEMHELFVEAQEAA
2705|chp|hut      KAEAQEIRSEASKHHQKVTELADEAQEHHNEMIEAYREADEIRDEADEMHEKFVEAQEAA
4058|hp|nph       KEEAQEVRAEASQHHQKVTELADKAQEHHNEMIEAYREADDIRDEADEWHDKFVEAQEAA
11820|hp|hma      KEEAEEVRSEASKHHQKVTELADEAQKHHNEMIEAYREADEIRDEADEKHEEFVDAQEAA
2345|hp|hhi       KEEAEEVRSEASKHHQKVTELADEAQKHHNEMIEAYREADEIRDEADEKHEEFVEAQEAA
                    :*:.:*:***:**:*******:**:***:*********:***:**  *: **:***:*

394|chp|nrc1      DAHHEAFVEVQKRLRELDKQEEEEEKDKRAQEQEEAREEAEEIYERFKEGETLDTEDLRK
23410|hp|hbo      DRHHEDFVRVQKRLRELDKQEEEERDAERAEKREAAKEEAEEIYQKFKEGETLDTEDLMK
1530|hp|hwa       DEHHEDFVRVQKRLRELDKQEEQEREDERTEEREAAKEEAEEIYQKFKEGETLDTEDLMK
452|hp|hla        DQHHEDFVRVQKRLRELDKEEEKERKDERAEKREEEKEEAEEIYQKFKEGETLDTEDLMK
2705|chp|hut      DQHHEDFVRVQKRLRELDKEEEEEERSRREEKQEAAREEAEEIYQEFKDGETLDTEDLMK
4058|hp|nph       DRHHEDFVRVQKRLRELDKEEEEEREEDRAEEREAAKEEAEEIYQKFKEGETLDTEDLMK
11820|hp|hma      DQHHEDFVRVQKRLRELDKKEEEQERSQREEKQEAAREEAEEIYQKFKEGETLDTEDLMK
2345|hp|hhi       DQHHEDFVRVQKRLRELDKKEEEQERSQREEKQEAAREEAEEIYQKFKEGETLDTEDLMK
                  * *** ** **********:**::    * ::.*  .*******: **:********* *

394|chp|nrc1      LQKSGHL
23410|hp|hbo      LQKTGLL
1530|hp|hwa       LQKTGLL
452|hp|hla        LQKTGLL
2705|chp|hut      LQKTGLL
4058|hp|nph       LQKAGKL
11820|hp|hma      LQKAGKL
2345|hp|hhi       LQKAGKL
                  ***:* *