HOG Organism Gene ID Name Annotation
aHOG2847 hbo HBOR33880 Hbor_33880 Sugar-specific transcriptional regulator TrmB
aHOG2847 hwa HQ1900 hypothetical protein
aHOG2847 nrc1 VNG6377 vng6377 no entry
MUSCLE (3.6) multiple sequence alignment


1900|hp|hwa         MSRTSNRADGDIVQDFLSVADLLEEPQLAQLYAYLAREGEATVQDVMDDLEIAQGTAYSY
33880|gene|hbo      MSRTSNRADGDIVQDFLSVADLLEEPQLAQLYAYLAREGEATVQNVMDDLKLAQGTAYSY
6377|hp|nrc1        ----------------------------------------------MDDLELAQGTAYSY
                                                                  ****::********

1900|hp|hwa         VNRLVDAGVVDITDDEQPRKYAAREIDLTVTTAAGDREYTITPALIDAVGRRETDADIDT
33880|gene|hbo      VNRLVDAGVVDVTDDEQPRRYAAREIDLTVTTAAGDREYTITPALIDAVGRRETNADIDT
6377|hp|nrc1        VNRLVDAGVVDVTDDEQPRRYAAREIDLTVTTAAGDREYTITPALIDAVGRRETDADIDT
                    ***********:*******.**********************************:*****

1900|hp|hwa         YIDRHGVAGLATALTYAVAREGGEVTHRLMAEDLEISPLAAEMILQALRPVVHEHYDIEE
33880|gene|hbo      YIDRHGVAGLATALTYAVARDRGEVTHRLMAEDLDISPLAAEMILQALRPVVHEHYEIEE
6377|hp|nrc1        YIDRHGVAGLATALTYAIARERGEVTHRLMAEDLDISPLAAEMILQALRPVVHEHYDIEE
                    *****************:**: ************:*********************:***

1900|hp|hwa         AGAGLNELDIDDGDAADDA
33880|gene|hbo      AGAGLEELAI-DGDGADDA
6377|hp|nrc1        AGAGLDELDIDDGDGADDA
                    *****:** * ***.****