HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0281COG1169arCOG02015Isochorismate synthaseisochorismate synthase

HOG Organism Gene ID Name Annotation
cHOG0281 nrc1 VNG1083 menF isochorismate synthase
cHOG0281 hmu HMUK0041 Hmuk_0041 isochorismate synthase( EC:5.4.4.2 )
cHOG0281 hma RRNAC0837 menF menaquinone-specific isochorismate synthase
cHOG0281 hwa HQ1872A menF isochorismate synthase
cHOG0281 hla HLAC1487 Hlac_1487 isochorismate synthase
cHOG0281 hbo HBOR17630 Hbor_17630 isochorismate synthase family protein( EC:5.4.4.2 )
cHOG0281 hut HUTA0814 Huta_0814 isochorismate synthase
cHOG0281 hvo HVO_1470 HVO_1470 menF menaquinone-specific isochorismate synthase
cHOG0281 nph NP2724A menF isochorismate synthase
cHOG0281 hhi 1476 menF menaquinone-specific isochorismate synthase
MUSCLE (3.6) multiple sequence alignment


1083|gene|nrc1      ----MSSLAGETTADG----PVVATSCRVADVS--TRAFLAAHAEPGFHWADPDGLELSG
814|gene|hut        ----MESVRADAVGTEHAGEILAVRGCQLDAVDPATLLAGDVEKRPWTAWAGPEET-IAT
10837|gene|hma      ----MEPLRGDETTVGET--TVVARGCRLDDAP--VRSVLVTDARPRFFWAAGTES-IAA
1476|gene|hhi       ----MEPLRGDETTVGET--TVVARGCRLDDAP--VRAVLETDARPRFFWAAGTES-IAA
1872|gene|hwa       MKTSIQMMESRQTRLDDV--TLVSRSARIPSLSSSVRDIFDIATSPRVVWSAPDETTVLG
1487|gene|hla       ----MKRARSSPAS------TLVSRTTGIDAPA--FAAAFDALPAPRTTWNAPDDALVLA
2724|gene|nph       ----MEPLRSTELCPDET--QLVSRSRRLSAPP-DPRTALSMADAPRTLWAAPDEATVVG
17630|gene|hbo      ----MEM-------------HLVSRSVPVSAPS--FRAVLRAADAPRTVWSAPDKATVVG
                        :.               :.     :                *   *       :  

1083|gene|nrc1      AGTAASVTAAGGDRFAAVREWSTGLFADLT-HDG-PDAARPRLFGGFSFFDTHTA-AG--
814|gene|hut        TGTVATITATSGDRFERVRRQAASLFADRDVSEILPAFARPRLFGGFSFHSGGTDRHADA
10837|gene|hma      RGSAATVTADGQSRFDDVRTAVEALFDDCSVPDSLPSIARPRAFGGFAFHNGTHE-GEDS
1476|gene|hhi       RGSAATVTADGQSRFDDVRTAVEALFADCSVPDDLPSVARPRAFGGFAFHNGTHE-GEDS
1872|gene|hwa       SGAAATIVATGSDRFESVRDAAESLFSTGDVHAG-SEVARPRLFGGFAFHAERAD-SK--
1487|gene|hla       SGAAATLTASGPDRFAEIRAGADDLFDSGDVHAG-TEAARPRLFGGFAFHDGGCD-GD--
2724|gene|nph       SGAAETIRADGNDRFRAVREAANELFATGDVHAG-TLSARPRLFGGFAFHDEHDP-AG--
17630|gene|hbo      SGAAATVTADGPDRFDRIREAAEELFSSGDVHAG-TEAARPRLFGGFAFHADSTD-GS--
                     *:. :: * . .**  :*     **         .  **** ****:*.          

1083|gene|nrc1      VWQGFPPARFVLPAIQLTSVGDET------------WLTAIEAGPDATVASASASLADAR
814|gene|hut        DWTGFPDAYFHLPTVSVIERDGET------------WLTTAAVGPDAATTA-EAARNRWE
10837|gene|hma      PWDGFPSAAFFLPEIQVTRRDDDA------------WLTTVATGPEAATEA-EALLEEWR
1476|gene|hhi       PWDGFPSAAFFLPEIQVTRRDDDA------------WLTTVATGPEAATEA-ETLLEEWR
1872|gene|hwa       PWKQFPNAQFIFPRVQITWSTDTHTETDTADNDSHAWITVNAVDPGATPDAVEYRLSQEI
1487|gene|hla       PWGPFPEARFVLPRVQVTFADNGT------------WLTVNAVGDDADPDAVEARLATER
2724|gene|nph       PWRGFPGARFVLPETQLTYAEDGT------------WLTVHGVGRD--VEAVESALEAAA
17630|gene|hbo      PWEDFPGARFVFPRVQVTYAENGT------------WLTVNAVGPDANAEAVEERLARER
                     *  ** * * :*  .:    .              *:*.  ..      : .       

1083|gene|nrc1      DAVDSLPAMQAAGPRPGVTDTTPTPGRDAWTAGVQDAVDRIQSGPLRKVVLATALRADLA
814|gene|hut        SRLT--DAHPTASRPPGIAARSQIPEREAWAEQVGAAVERIDRGDLRKVVLAGAQTVELA
10837|gene|hma      DRLVA-DSERNPGTPPGISHRKRTPTQDGWREQVAAATESIDRGELQKVVLAQSLSATLD
1476|gene|hhi       DRLVA-DSERNPGTPPGISHRKRTPTQDGWREQVAAATESIDRGELQKVVLAQSLSATLD
1872|gene|hwa       ERVKTLESTNNSRSPPGVTCRHRRTSRDAWNRGVTAAINRISADNLQKVVLAQALEVELE
1487|gene|hla       DRLAGLATTVDRPPRPGIAATRRTTSREAWRRSVEAAVDRIRGGDLQKVVLAQALEADLA
2724|gene|nph       DRFDGATTPRPPAGPPGIERRERTTSKDRWRESVTAAIDRIEAGELRKVVLAQALQTALS
17630|gene|hbo      ERIESLPDPGPVSDPPGVVHRRRTTAKDDWNAGVNAAVERISAGDLRKVVLAQALAADLA
                    . .            **:      . .: *   *  * : *  . *.***** :  . * 

1083|gene|nrc1      EPATPCALLERLRQRYPACFRFLVAPADGG----------------------------VF
814|gene|hut        GPLSVPAALDRLGETYPDCYRFGFAPAAAG--------------------------SGTF
10837|gene|hma      AELSVPDVMARLSKTYPDCYRFMLSPDSGG----------------------------TF
1476|gene|hhi       AELSVPDVMARLSKTYPDCYRFMLSPDSGG----------------------------TF
1872|gene|hwa       ETPVLGDIITRLGEHYPSCYRFIIEPVPGTPVDQRIHTDVNAMTTVGSEDIHNTSQSPAF
1487|gene|hla       APFPRAATLDRLAEKYPDCHRYYFEPDAGG---------------------------SAF
2724|gene|nph       RPVSLPDVLTRLADTYPDCYRFLIEPDDGG---------------------------AGF
17630|gene|hbo      SDLSVPDILDRLGDSYPDCYRFLVEPEPDA-----------------------DRPQASF
                            : ** . ** *.*: . *                                 *

1083|gene|nrc1      LGATPERLASLRGGRVETVALAGSVGRGDSPAADARLADRLRESDKLRHEQGVVVDTIAR
814|gene|hut        FGATPERLLRRDGRRVQTTALAGSIGRGETRAEDEWLAEELTASPKDGHEHALVVEAIRA
10837|gene|hma      FGATPERLVSVRGRTVRTEALAGSTGRGDTPAEDEWLAAELLDSEKDRHEQKLVADAIRD
1476|gene|hhi       FGATPERLVSVRGRTVRTEALAGSTGRGDTPAEDEWLAAELLDSEKDRHEQKLVADAIRD
1872|gene|hwa       FGATPERLVSVRGRTVETGALAGTTGRGETTAEDEWLAAELARDEKNVHEHELVAETIRE
1487|gene|hla       FGATPERLVALRGRTVETDALAGTTGRGETPAEDEWLARELLDDAKNVHEHELVADTVRE
2724|gene|nph       FGATPERLVGRRGRTVETGALAGTTGRGDTPLEDEWLAEELRSDAKNVHEHELVADAIRD
17630|gene|hbo      FGATPERLVSLRGRTVETGALAGTTGRGETPAEDEWLARELLDDEKNVHEHELVAETIRD
                    :*******    *  * * ****: ***::   * .**  *  . *  **: :*.:::  

1083|gene|nrc1      RLEGIGD-VAVGDRDVRQLSTIQHLETPISAAVSADTHVLDVIETLHPTPAVNGLPPADA
814|gene|hut        QLDDFADHVETGERTVRQLATVQHLQTPIEATLDEEVHVLSLVEALHPTPAVGGLPPDDA
10837|gene|hma      QLEPFASTVRIGDRTVRRLATVQHLRTSITAELDDDEHVLSLVEALHPTPAVGGLPPDAA
1476|gene|hhi       QLKPFASTVRIGDRTVRRLATVQHLRTSITAELDDDEHVLSLVEALHPTPAVGGLPPDAA
1872|gene|hwa       QLSPYATAITSDSRRVRKLATVQHLWTPITATLEEDKHALSLVEALHPTPAVGGLPPTTA
1487|gene|hla       QLEPFAASISAGERRVRRLATVQHLHTPITAELNADRHVLDLVEALHPTPAVGGLPPDRA
2724|gene|nph       QLQPYAASVRTGERGVRRLATVQHLETPITAELAADEHVLSLVEALHPTPAVGGLPPDKA
17630|gene|hbo      QLAPFASSVNTGDRCVKRLATVQHLWTPITATLATSEHVLSLVEALHPTPAVGGLPPEKA
                    .*   .  :  ..* *..*:*:*** *.* * :  . *.*.::*:*******.****  *

1083|gene|nrc1      LATIRDTETFDRGWYAAPIGWIDADGDGTFGVGLRSGVVDDDSVTLFAGNGIVGDSTPDA
814|gene|hut        LAAIQESEAFDRGWYAAPIGWFDAAGDGEFAVGIRSALAHDREATLFAGAGIVADSDPDA
10837|gene|hma      LRTIRETEAFDRGWYAAPVGWVDAAGNGTFAVGIRSAVATEREATLFAGAGIVADSDPDR
1476|gene|hhi       LRTIRETEAFDRGWYAAPIGWVDAAGNGTFAVGIRSAVATEREATLFAGAGIVADSDPDR
1872|gene|hwa       AETIRETEPFDRGWYAAPVGWIDAAGYGTFVVALRSAVAHDDAATLFAGVGIVADSNPDS
1487|gene|hla       LETIHDTEPFDRGWYAAPVGWIDAAGNGAFAVAIRSAVATPRRATLFAGVGLVADSDPDR
2724|gene|nph       LATIRDTEPFERGWYAAPVGWFDAAGNGSFAVAIRSAVAHGEAATLFAGVGIVADSDPDR
17630|gene|hbo      LETIRDTEPFDRGWYAAPVGWIDAAGYGSFAVALRSAVSRDDTTTLFAGVGVVEDSDPDR
                      :*.::*.*:*******:**.** * * * *.:**.:     .***** *:* ** ** 

1083|gene|nrc1      EWEEVQLKYRPVLDELQ-------------------------------------------
814|gene|hut        EWDEIQLKYRPILDALR-------------------------------------------
10837|gene|hma      EWDEVQLKYRPILDELE-------------------------------------------
1476|gene|hhi       EWDEVQLKYRPILDELE-------------------------------------------
1872|gene|hwa       EWDEVQLKYRPILDELESNDADDDTINQAQSEISTHTQGTVDDTMNESASTSISTPDTTV
1487|gene|hla       EWDEVQLKYRPILDELEDGN----------------------------------------
2724|gene|nph       EWDEVQLKYRPILDELE-------------------------------------------
17630|gene|hbo      EWDEVQLKYRALLDELER------------------------------------------
                    **:*:*****.:** *                                            

1083|gene|nrc1      ----------------------------------------
814|gene|hut        ----------------------------------------
10837|gene|hma      ----------------------------------------
1476|gene|hhi       ----------------------------------------
1872|gene|hwa       PSESNSQSNTTMEPTSDADADADADVDADADTNTNIDDTE
1487|gene|hla       ----------------------------------------
2724|gene|nph       ----------------------------------------
17630|gene|hbo      ----------------------------------------