HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0280arCOG04707hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0280 nrc1 VNG0125 vng125 no entry
tucHOG0280 hmu HMUK0579 Hmuk_0579 conserved hypothetical protein
tucHOG0280 hma RRNAC2308 hypothetical protein
tucHOG0280 hwa HQ1137A hypothetical protein
tucHOG0280 hla HLAC0081 Hlac_81 hypothetical protein
tucHOG0280 hbo HBOR27260 Hbor_27260 hypothetical protein
tucHOG0280 hut HUTA1830 Huta_1830 conserved hypothetical protein
tucHOG0280 hvo HVO_0508 HVO_0508 conserved hypothetical protein
tucHOG0280 nph NP0412A hypothetical protein
tucHOG0280 hhi 2762 HAH_2762 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1137|hp|hwa       MSSQSTL-SDDDLFGEAAEEMREEVEAHLDNAHAALPDAASMWQT-NADNVLGALNGLRS
27260|hp|hbo      MSSQSTL-ADDDLFGEAAEEMRAEVEEHLDAAREELPDADTVWSA-EADNILGVLNGLRS
125|hp|nrc1       -MSQSSL-DDDELFGEAAEEMRADVEGHIEAARDALPDDDALWEVDDGGNTLGVLNTLKT
81|hp|hla         -MSQSTFDDDDDLFGEAAEETRAEVEEHLQAARAELPDADAVWET-DADNVLGALNGLKS
12308|hp|hma      -MSQSSL-DDDELFGEAANEMRTDVEESLAEARNALPAADSVWDV-EADNTLGVLNSLKT
2762|hp|hhi       -MSQSSL-DDDELFGEAANEMRTDVEESLAEARDALPEADSVWDV-EADNTLGVLNSLKT
412|hp|nph        -MSQATL-DDDDLFDEAATEMREDVEASLDAAREELPAAADIWTT-DAGNTLGVLNGLKE
1830|chp|hut      -MSQSTL-DDDDLFGEAANEMRSDVEEHLEAARDELPDPDAIWDV-EADNTLGVLNALRS
                    **:::  **:**.*** * * :**  :  *.  **    :* . :..* **.** *. 

1137|hp|hwa       ALDAGDAEEHLRQAKKTFVVGTRADAFDDPDELRSEVESVEELLSSINTADELASELTTT
27260|hp|hbo      SLDVGDAEDNLRQAKKTFIIGQRAEAFDDADDLEEEIASVEELLETLGDAGDLVGELTST
125|hp|nrc1       ALNTEEVASHVRDAKKAFVIGQRADAF-DGDDLADDLAAIEDVLADLEAASEHAGALAET
81|hp|hla         ALDVGDAVDSVRSAKKAYVLGERADAFEDADDLKAEIEALESLVADIEAAAEEVASLTGT
12308|hp|hma      ALDVGDAEDHLRDAKKWYTMGERADAFEDADDLAEEIETIADLIDDVDDAREQVGDLTAT
2762|hp|hhi       ALDVGDAEDHLRDAKKWYTMGERADAFEDADDLAEEIETIADLIDDVDDAREQIGDLTAT
412|hp|nph        SLDTGEAETHLRDAKKWFTMGRKADAFEDADDLETDIAALEALLEDIETAHEQVSDLTAT
1830|chp|hut      ELDPGEAETHLRDAKKWYTMGERADAFDDAGDLEDEIDAVEGVITDLSAAREQVSDLAGT
                   *:  :.   :*.*** : :* .*:** * .:*  :: ::  ::  :  * :  . *: *

1137|hp|hwa       VPQLHDQLP-------------EADEESDE----------------
27260|hp|hbo      MPQLRSQLQDAADAVDAAESEADTDEDTEESDADADDTADEAEADD
125|hp|nrc1       LPELRGALP---------------DE--------------------
81|hp|hla         VPAIRGALQ---DAAEAGDDESEDDEDGEDEE--------------
12308|hp|hma      IPQLRSTLEE-FEGEDGADAEADGDADAEAEA--------------
2762|hp|hhi       IPQLRSTLEE-FEGEDGADAEADGDADAEAEA--------------
412|hp|nph        IPELRSALD-------------DSDD--------------------
1830|chp|hut      VPEIRSALE-------------SADEESESDE--------------
                  :* :.. *                *