HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0028COG0402KOG3968Cytosine deaminase and related metal-dependent hydrolasesatrazine chlorohydrolase

HOG Organism Gene ID Name Annotation
cHOG0028 nrc1 VNG6258d hacA atrazine chlorohydrolase
cHOG0028 hmu HMUK2578 Hmuk_2578 amidohydrolase( EC:3.5.4.3 )
cHOG0028 hmu HMUK0929 Hmuk_0929 amidohydrolase( EC:3.5.4.3 )
cHOG0028 hma RRNAC1926 trzA2 N-ethylammeline chlorohydrolase
cHOG0028 hma RRNAC3551 trzA4 chlorohydrolase family protein
cHOG0028 hwa HQ2620A guaD nucleoside deaminase (cytosine deaminase, guanine deaminase)
cHOG0028 hwa HQ3010A guaD nucleoside deaminase (cytosine deaminase, guanine deaminase)
cHOG0028 hla HLAC1568 Hlac_1568 amidohydrolase
cHOG0028 hbo HBOR11160 Hbor_11160 cytosine deaminase-like metal-dependent hydrolase( EC:3.5.4.3 )
cHOG0028 hbo HBOR36590b Hbor_36590 hypothetical protein
cHOG0028 hbo HBOR38560b Hbor_38560 Cytosine deaminase and related metal-dependent hydrolases( EC:3.5.4.3 )
cHOG0028 hut HUTA0755 Huta_0755 amidohydrolase
cHOG0028 hvo HVO_2483 HVO_2483 amidohydrolase putative (TBD)
cHOG0028 nph NP2032A guaD_2 nucleoside deaminase 2 (cytosine deaminase, guanine deaminase )
cHOG0028 nph NP4788A guaD_3 nucleoside deaminase 3 (cytosine deaminase, guanine deaminase )
cHOG0028 hhi 2436 trzA2 N-ethylammeline chlorohydrolase
cHOG0028 hhi 762 HAH_0762 amidohydrolase
MUSCLE (3.6) multiple sequence alignment


36590|hp|hbo        ------------------------------------------------------------
2620|gene|hwa       -------------------------------------------------------MERFE
4788|gene|nph       -------------------------------------------------------METLE
11926|gene|hma      -------------------------------------------------------MERIE
2436|gene|hhi       -------------------------------------------------------MEAIE
6258|gene|nrc1      MRPPAPPTPMATTRIPPYSATTRKSTQERACATPPQSVGTRAFENAYRSPVPSAGMTELA
38560|gene|hbo      -------------------------------------------------------MEALS
3010|gene|hwa       --------------------------------------------------------MFVE
1568|gene|hla       --------------------------------------------------------MHLE
11160|gene|hbo      --------------------------------------------------------MIVE
13551|gene|hma      ------------------------------------------------------------
762|gene|hhi        --------------------------------------------------------MILQ
755|gene|hut        --------------------------------------------------------MQLE
2032|gene|nph       --------------------------------------------------------MELS
                                                                                

36590|hp|hbo        ------------------------------------------------------------
2620|gene|hwa       GTILRGETLEPVRGRVLIDNGEIMAVEE---EPNSSTDIILPAFVNAHTHLGDSVATEAA
4788|gene|nph       GTVLAGRSFDPMYGRVVIEEGHITAVERIDDHDGDASRIILPAFVNAHSHVGDSVAKEAA
11926|gene|hma      GTILAGRSFEPVDGNVVVEDGYITAIEETPARESDHDRIVLPAFVNAHTHVGDSVAKEAA
2436|gene|hhi       GTVLAGRSFEPVHGSVVVEDGYITAIEETSERESDHDRIVLPAFVNAHTHVGDSVAKEAA
6258|gene|nrc1      GTVLAGDAFEPTRGRVVIDDGRIDAVEE--DTHVDSEDIILPAFVNAHTHLGDSIAKEAA
38560|gene|hbo      GTLLVGRSFEPMRGRVVVEDGQIERIEE---TETTSTDIILPAFVNAHTHLGDSVAKEAA
3010|gene|hwa       GTLLYGRRFDPIEGRIIIEDGEIVTIEE---VAVDSTDIVLPAFINAHTHLGDSIAKEAG
1568|gene|hla       GTVLVGPEFEPVEGRVIVADDEIVRIEE---TSVDSDDVILPAFVNAHTHIGDSIAKEAG
11160|gene|hbo      GTILTGRDFEPVQGRVVVEDGEITAIEE---ADVDNSNVILPAFVNAHTHIGDSIAKEAG
13551|gene|hma      ------------------------------------------------------------
762|gene|hhi        GTILTGRSFEAIEGRVVVENGQIAAVEE---TAVDSDDIVVPAFVNAHTHIGDSIAKEAG
755|gene|hut        GTILRGREFAPVEGRVVVEDGEITAVEE---ASIDTDQIILPAFVNAHTHIGDSIAKEAG
2032|gene|nph       GTILAGPDYEPIEGRVVVEDGEITAIEE---VETASSDIICPAFVNAHTHIGDSIAKEAG
                                                                                

36590|hp|hbo        MTIYMTEAERTEDGARHER-----------------------------------------
2620|gene|hwa       VGLSLTDAVAPPDSLKHRRLSAVDRETLIESIYRTLGFMQSTGTGTCLDFRESGLSGATA
4788|gene|nph       VDLGLEAAVAPPDSLKHQRLQAADRETAVDAMYRTLRFMQQTGTAAFLDFREFGIEGAKT
11926|gene|hma      VGLGLEEAVVPPDSLKHQQIEAADDETLIAAMHRTLRFMQRTGTAAFLDFREFGIDGATA
2436|gene|hhi       VGLGLEEAVVPPDSLKHQQIAAADDETLIAAMHRTLRFMQRTGTAAFLDFREFGVDGARA
6258|gene|nrc1      VGLSLDDAVAPPNSLKHRRLAAADDDDLVAAMRHTLTFMHQTGTVACLDFRESGRPGTEA
38560|gene|hbo      IGLSLDKAVAPPDSLKHRRLAAADRSDLVSAMRRTLRFIERTGTVSCLDFRESGTAGARA
3010|gene|hwa       AGLSLDALVAPPDGLKHRLLDSATQDEIVAAMRRSLRLMTASGTAACIEFREGGVDGVEA
1568|gene|hla       EGLSLDELVAPPDGLKHRLLREASHEAKVAAMARSLRYMESTGTGTFLEFREGGVKGVAA
11160|gene|hbo      AGLSLDELVAPPDGLKHRLLRAASHAAKVEAMRRSLRLMQSTGTATCLEFREGGVDGVEA
13551|gene|hma      -------------------------------MERTLSFMEQAGTGAFIEFREGGVEGVRA
762|gene|hhi        EGLSLEELVAPPDGLKHRLLRDASRDELVAAMARTLSFMEQSGTGAFIEFREGGVEGVRA
755|gene|hut        AGLSLDELVAPPDGLKHQLLREASREELVAAMRRSLSFMERAGTGAFLEFREGGVSGVEA
2032|gene|nph       RGLSLDELVAPPDGLKHRLLDDASREELVAAMARSLQFMQAAGTGACIEFREGGVEGIEA
                                                                                

36590|hp|hbo        ------------------------------------------------------------
2620|gene|hwa       LRSAASK-------RDLTAFIFGSGEDDVLDVADGYGASGATDDDFSAQRTAAQMADMPF
4788|gene|nph       LREAAEG-------LDIEAFIFGSDDAAVLDVADGFGASGANDDDFTSQRAAAAARGVPF
11926|gene|hma      LREAASG-------LDIEDFIFGSDDSAVLDVADGFGASGANDDDFTTERAAAEERAVPF
2436|gene|hhi       LREAAEG-------LDIEAFIFGSDDTAVLDVADGFGASGANDDDFTARRTATEERGAPF
6258|gene|nrc1      LRAAADT-------VDVTPFIFGSGDPDVLDIADGYGASGANDNDFADERAACTRRDAPF
38560|gene|hbo      LHEAAAS-------VSLDPFIFGSGKKSVLDVADGYGASGANDGDFTEQRAACRKRDVPF
3010|gene|hwa       IRKAGSD-------LPIETVVLGRESEAAMHTADGFGASGARDGEFEQIRSATRDANKLF
1568|gene|hla       LRDAVAGEGVDFGERAIDPVVFGRDDPDVLSVADGYGASGARDADFDAVRSETREAGKLF
11160|gene|hbo      IREAADE-------LAIDPVVLGRETAAAMRESDGFGASGARDSEFGDLRAETREAGKLF
13551|gene|hma      IQDALSD-------SPLESVVLGRETTDAMELGDGFGASGANDSEFGAERRATRQAGKLF
762|gene|hhi        IQDALAG-------SDLDSVILGRETTDAMELADGFGASGANDSEFGAERRATRQAGKLF
755|gene|hut        IEAALDG-------LAIEGVILGRETIDAMAAADGFGASGARDGEFGAERSATREAGKLF
2032|gene|nph       LQAATAG-------LDIESVALGRDTTDVLDIADGYGASGARDGDFSAERTATGRAGLLF
                                                                                

36590|hp|hbo        ---------------------------HRVSRHL--------------------------
2620|gene|hwa       GIHAGEPDASDIHAALALDPDLLVHMVHAEAEHLTEVADNSIPVVVCPRANHVLDVGRPP
4788|gene|nph       AIHAGEPDATDIHPALDLEPDLLVHMVHAEAEHLERVADQETPIAVCPRANRVLGVGRPP
11926|gene|hma      AIHAGEPDATDIHPALDLDPDLLVHMVHAEAEHLERVADQNVPIAVCPRANRVLGVGRPP
2436|gene|hhi       AIHAGEPDATDIHPALDLEPELLVHMVHAEAEHLERVADQDVPIAVCPRANRVLEVGRPP
6258|gene|nrc1      AIHAGEPDATDIHPALDLEPDLLVHMVHAEDTHLTRVADQSVPIAVCPRANTVLDVGDAP
38560|gene|hbo      AIHAGEPDATDIHPALDLEPDLLVHMVHAEQDHLQRVTEQSVPVAVCPRANTVLDVGTPP
3010|gene|hwa       GIHAGERDADDITPAFNLDPDFLVHMVYPNTDHLTRLATEQIPTVVCPRSNLVTGVGVPP
1568|gene|hla       GIHAGERDADDINAAMDLDPDFLVHMVHAEPIHLERLADRGTPVAVCPRSNLVTNVGVPP
11160|gene|hbo      GIHAGERDPHDVDPALDLDPEFVVHMVHPEPEHLDRIEAEDVPIVVCPRSNLVTGVGVPP
13551|gene|hma      GIHAGEVDSSDINPALDLDPDFLVHMVHAKSLHLERVADSEIPVVVCPRSNIVTGVGRPP
762|gene|hhi        GIHAGEVDSSDINPALDLDPDFLVHMVHAESLHLERVADSEIPVVVCPRSNIVTDVGRPP
755|gene|hut        GIHAGERDSDDVNPALDLDPDFLVHMVHLDAIHYERLDDEGTPVVLCPRSNLVTDAGVAP
2032|gene|nph       GIHAGERDAHDINPALDLEPDFLVHMVHAEPLHLERVADRGTPVVVCPRSNLVTDVGVPP
                                               :    *                           

36590|hp|hbo        ------------------------------------------------------------
2620|gene|hwa       IRELLDHTTVALGTDNVMLNSPSMFREMAYTAKHFDVTAREVLQMATIAGAEAVGLNCGV
4788|gene|nph       IETLLEYTDVALGTDNVMLNPPSMFREMAYTAKTFELPSQTVLRMATTAGAEAVGLDCGV
11926|gene|hma      IETLLEYTDVALGTDNVMLNAPSMFREMEYTAKTFDLSSRTVLRMATTAGAEAVGLDCGV
2436|gene|hhi       IETLLEYTDVALGTDNVMLNAPSMFREMEYTAKTFDLPSRTVLRMATTAGAEAVGLDCGV
6258|gene|nrc1      IPALLDHTTVALGTDNVMLNPPSMFREMATTAKRFDVSATDVLRMATTAGAEIAGLDCGV
38560|gene|hbo      VRELLDHTTVALGTDNVMLNPPSMFREMAYTVKQFDVTAREVLRMATTAGAEIVGLDCGV
3010|gene|hwa       ISDLAERTTLALGTDNAMLNAPSMFREMAYTAKLADVSARTILEMATINGAEIANLDYGL
1568|gene|hla       IRDLAERTTVALGTDNVMLDSPSMFREMEFAAKLSDLPAREILRMATVNGAAIAGLNRGV
11160|gene|hbo      VRDLLDRTTVALGTDNVMLNSPSMFREMEFVSKLTDASATEILRMATLNGAEIAGLNYGV
13551|gene|hma      VEALADRTTVALGTDNVMLNSPSMFREMEFTAKLYDLSAREVLRMATVNGAEISGLGGGL
762|gene|hhi        VEELADRTTVALGTDNVMLNSPSMFREMEFTAKLYDISAREVLRMATVNGAEIAGLGGGL
755|gene|hut        ARELFDRTTVALGTDNVFLNSPSMFREMEFAAKLYDVSAREVLQMATVAGAEIAGLDAGV
2032|gene|nph       VADLLERTTVALGTDNVLLNSPSMFREMAVTAKLCDVTAPEVLRMATAAGAEIAGLNCGV
                                                                                

36590|hp|hbo        -----------------------------------------------------
2620|gene|hwa       IDVGRRAALLIIDGDSNNLSRAVDPIRAVVRRAGPLDVTRVVL----------
4788|gene|nph       IEPGRRAALLVLDGDSDNLSGVADPVDAVVRRATALDVERVIC----------
11926|gene|hma      IEPGRRAALLVLDGDSDNLSAVADPVDAVVRRASPLDIDRVIC----------
2436|gene|hhi       IEPGRRAALLVLDGDSDNLSAVADPVDAVVRRASPMDIHRVVC----------
6258|gene|nrc1      IEPGRRAALVVLDGDSHNLRNAVDPVQAVVRRATGLDVKRVLT----------
38560|gene|hbo      IAPGRRAALLVLNGDSDNLTGSVDPVQAVVRRATELDVKRVLV----------
3010|gene|hwa       IEPGCEAKLLVLDGDSDNLAGAQDIVRAVVRRADRADVSEVIT----------
1568|gene|hla       IELGADADLLVLDGDSDNLAGAHDLVRAIVRRAGAADVSRVVIGGEPAGRETV
11160|gene|hbo      IEPDREAKLLILDGDSDNLAGAQDLVRAVVRRAGQADVKDVLL----------
13551|gene|hma      IKTGQPARLLVLDGDSDNLCGAQNPVRAVVRRAGTADVRRVVHPMTE------
762|gene|hhi        VKPGQPARLLVLDGDSDNLSGARNPVRAVVRRAETADVRRVVHPGTE------
755|gene|hut        IEPGREARLLVLDGDSDNLAGAEDVVRAVVRRAGVDDVTDVLLAN--------
2032|gene|nph       IEPGRRARLLVLDGDSDNLAGVRDPVRAVVRRAGVNDVKNVVLQ---------