HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0279COG3389arCOG04463Uncharacterized protein conserved in archaeahypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0279 nrc1 VNG1365 vng1365 no entry
cHOG0279 hmu HMUK2788 Hmuk_2788 Protein of unknown function DUF1119
cHOG0279 hma RRNAC0039 hypothetical protein
cHOG0279 hwa HQ1505A hypothetical protein
cHOG0279 hla HLAC0688 Hlac_688 Protein of unknown function DUF1119
cHOG0279 hbo HBOR22950 Hbor_22950 uncharacterized conserved protein
cHOG0279 hut HUTA2507 Huta_2507 Protein of unknown function DUF1119
cHOG0279 hvo HVO_1107 HVO_1107 conserved protein
cHOG0279 nph NP3808A hypothetical protein
cHOG0279 hhi 799 HAH_0799 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1365|chp|nrc1      MNDSTRVAAVLAGVVALFVVVQVGALALVEPFQSAGLQSTENPQNPLNSVVYVAFLLVAT
3808|hp|nph        ---MKRAFAAVAATVCLFLLVQLGSLALVEPFMSAGFQAVEDPSDPTNSLLYIIAILVAT
2507|hp|hut        MARYRGLTLSISVIVSIFLFVQLGALALVDPFKTAGLQAVEDPQNPVNSLLYIAAILVMT
10039|hp|hma       MERRWRILGGCGLIAGIFLFVQLGALALVQPFESAGYQAVEDPSDPTNSLMYIGAILVAT
799|hp|hhi         MERRWRILGGCGLIAGIFLFVQLGALALVQPFESAGYQAVEDPSDPTNSLMYVGAILVAT
688|gene|hla       --MFPREYRGVAFVVGLFLVVQLGALALVPEFAESGYQAVDNPDNPTNSLLYIAAIIAMT
1505|hp|hwa        --MHRRVAFGIGFTAVLFFLIQLGALALVPTFYEQGYQTVEDPTNPTNSLLYIGAILVAT
22950|hp|hbo       --MRNRVAFGIGLTTLIFLLVQLGALALVTPFYDGGFQTVEDPSDPTNSLVYIGAILVAT
                              .  . :*..:*:*:****  *   * *:.::* :* **::*:  ::. *

1365|chp|nrc1      GGILLVIKYDKQWILRGVVLVTSGLVASYVFAVAIPAVVVA----GVNLAVWGPALALVG
3808|hp|nph        GVMLAAMKFGVDRLLQGLVLFAAVFISFYVFTVVVPPVVAVA---GLNLVAVALALALGV
2507|hp|hut        GVMLAAFKYEVQWAIRGLIVATGAYIALLVFSILLPPVVTLPVGDGLHGLAWVGAIGLGV
10039|hp|hma       AVMLLAFRYDVDQLIRGLIVFSAAWLSLYVFQVLVPPVFTYA---GLNVGAVLLALGLGT
799|hp|hhi         AVMLLAFRYDVDQLIRGLIVFSSAWLSLYVFQVLVPPVLTYA---GLNVVAVLLALGLGT
688|gene|hla       GLMLAAFRYDLDQGIRLLIVGVSAWLSWYVFSAVVSQLAAAV-----------PAIAVGV
1505|hp|hwa        AVMLAAFKYELQWLVKGFITLAAGSLAWYVFSVFFSPLLAAI-----------PAVGLAV
22950|hp|hbo       AVMLAAFKYDFDWAVRALVVLTSGMLSWYVFSIILPFLPAVA-----------AAVLVAG
                   . :* .:.:  :. :. .:   .  ::  **   .. : .              *: :  

1365|chp|nrc1      ALYAYPEWWVIDAAGAIMGMGAAALFGISFGVLPAIVLLTALAVYDAISVYGTEHMLTLA
3808|hp|nph        GLLVYPEWYVIDAAGIVMGAGAAGLFGISFGLLPALVLLVVLAVYDAISVYGTEHMLALA
2507|hp|hut        ALYAYPEWYVIDATGAVMGAGAAGLFGITFGVFPALVLLSVLAVYDAISVYGTEHMLTIA
10039|hp|hma       ALLVYPEWYVIDSAGAVMGAAAAGLFGISFGVLPALVLLTVLAVYDAISVYGTEHMLTLA
799|hp|hhi         ALLVYPEWYVIDAAGAVMGAAAAGLFGISFGVLPALVLLTVLAVYDAISVYGTEHMLTLA
688|gene|hla       ALLVYPEWYVIDTAGVLMGAGAAGLFGISFGLLPALLLLAFLAVYDAISVYGTEHMLSLA
1505|hp|hwa        LLIIYPEWYIIDAAGVLMGAGAAGLFGISFGLLPALVLLSILAVYDAISVYGTEHMLDLA
22950|hp|hbo       ALVVYPEWYVIDATGIIMGAGAAALFGISFGLLPAVVLLTALAVYDAISVYGTEHMLDLA
                    *  ****::**::* :** .**.****:**::**::**  **************** :*

1365|chp|nrc1      SGVMELRLPIVLVVPTTLAYSFVEDAA---------------------------------
3808|hp|nph        SGAMDLRLPVIFVVPLTLSYSFLDADNPESLEDDTPESDAEAEPDEGDDVSTATGDAEPV
2507|hp|hut        SGVMDLKVPVVLVAPMSVGYSFREDTAGLDEESDNEQADPTADDATTEP-----------
10039|hp|hma       SGVMDLRVPVVLVIPMTLSYSYLDATTPNPTAEDETSDDSAAANDDTEA-----------
799|hp|hhi         SGVMDLKVPVVLVIPMTLSYSYLDATAADSVAEDETDDDATAADDAAEEPATTEHGADAD
688|gene|hla       EGVMDLNIPVVLVIPLSLSYSLLGEQS--ESEGDDTDGDSAIDDGDPDA-----------
1505|hp|hwa        AGVMDLNLPVILVIPTTLSYSLREDVS--PVATDDNTNVSVSDNETHTH-----------
22950|hp|hbo       EGVMDLHIPVVLVIPTTLSYSLLDD-------------DFSSANDVHDD-----------
                    *.*:*.:*:::* * ::.**                                       

1365|chp|nrc1      -----------------ETADEAEAGEREAAAPAD-RPAYFIGLGDAVMPSIMVASAAFF
3808|hp|nph        DTMAEDADTDADSDADADDPAAAEAAPDEHADPFA-RDAFFIGLGDAVIPTILVASAAFF
2507|hp|hut        -----------EDTDVTAESGSAEAAEGDSADPLEDREALFIGLGDAIIPTVLVASAAFF
10039|hp|hma       ----------------TTGTGEADESDDVHADPLE-RDALFIGLGDAIIPSILVASAAFF
799|hp|hhi         GPAVADGSQPAERPDDATETGKADGTADVHADPLE-RDALFIGLGDAIIPSILVASAAFF
688|gene|hla       ----------NSDDLDNPDESADEGADVSEPTDIEDRDAFFIGLGDAVIPTVLVASAATF
1505|hp|hwa        -----------ANELAEHDAETPSSIDETSTDDSHIRDAFFIGLGDAVMPTVLVASAAFF
22950|hp|hbo       -----------PDAEAPPSPESDGGDPTDDSDEEGVRDAFFIGLGDAVMPTVMIASAAFF
                                                 .     * * *******::*::::**** *

1365|chp|nrc1      LDTPP-----VVAGI---ELAPLTAMAGTLVGLLVLMRMVFAGRAHAGLPLLNGGAIAGY
3808|hp|nph        RPGGV-E-LLSVPGI-ALTVPALGAMVGTIAGLLALMWFVMKGRAHAGLPLLNGGAIAGY
2507|hp|hut        ADASVPTVDIGAFSV---AVPAATAVVGTFLGLAVLLRMVLAGRAHAGLPLLNGGAIAGY
10039|hp|hma       ASSDV----LSVFGV---PLPALTAMVGSYVGLTILLWMVLKGRAHAGLPLLNGGTIAGY
799|hp|hhi         ASSDV----LSVFGV---PLPALTAMLGSYVGLAILLWMVLKGRAHAGLPLLNGGTIAGY
688|gene|hla       SPAAA-L-DMPLIGI---NLPALLAMVGSLAGLLVLMSWVIKGRPHAGLPLLNGGAIGGY
1505|hp|hwa        LPGEL-TPSLGIFGIPAMTLPALTAMIGTFIGLFVLMWLVVKGRAHAGLPLLNGGAIGGY
22950|hp|hbo       LPDAA-APSLGVPGLPILTLPVLTAMVGTFAGLFALLWLVLKGRAHAGLPLLNGGTIGGY
                                .:    :.   *: *:  **  *:  *. **.**********:*.**

1365|chp|nrc1      LVGAVAAGIPILDALGVAAYL
3808|hp|nph        LLGAAAVGIPVVEALGVAPYL
2507|hp|hut        LVGALASGMTLVETLGLGPYL
10039|hp|hma       IVGALAAGISLVDALGLGPYL
799|hp|hhi         IVGALAAGISLIDALGLGPYL
688|gene|hla       LIGSVVAGVPLIEAVGLAGFL
1505|hp|hwa        LIGALLSGVPLIRALGL----
22950|hp|hbo       LIGAVLSGIPVLTAIGL----
                   ::*:   *:.:: ::*: