HOG Organism Gene ID Name Annotation
aHOG2782 hla HLAC0940 Hlac_940 protein of unknown function UPF0118
aHOG2782 hla HLAC1950 Hlac_1950 protein of unknown function UPF0118
aHOG2782 nph NP1894 permease
aHOG2782 hma Hma_65307 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


940|gene|hla       MPDRSAPPTWLVGKPGLTALVLLSSLLALFVLLPYLQFILFGVVLAYILFPVQQRAE---
1894|gene|nph      MDDGDDLSEWFSDRLTLTVVTAVSVVLGLLVVIPYLEYVLLGAVLAYVLLPVQRRLE---
1950|gene|hla      ---------MNRGQSFLLLLIGSVALLTLFVIRPFIEYVIASAILAYVLFPFHVRLSRGL
65307|hp|hma       -----------------------------MLIRPFLQYILGAVLLAYVLYPLQIRLE---
                                                ::: *:::::: ..:***:* *.: * .   

940|gene|hla       -------------QHVRPTIAAIVIVLGALLFVLIPIIYLLTIAVQQSLRVVSAVRNGQI
1894|gene|nph      -------------AHVGRLVAAVSISVATVLAFLLPLLTVLAIALREAVAVATALQRGVV
1950|gene|hla      QEGLSNRFRESLARQLGYMLSALFLIVSSIVAVILPLAYISWVFVRDLTEIAR--GNSDI
65307|hp|hma       -------------TYVSPMLAALSLVTLAVTGFVAPVVVVLASIMESADRILREFGTDPV
                                  :   ::*: :   ::  .: *:  :    : .   :      . :

940|gene|hla       DVASIE-ELLESTGYRIDLVALYESNQERIATSLQEVTSGAIDLAGSLPGLFIGLTITLF
1894|gene|nph      DVPGIELWVEETTGFEVDLVNLYSTYEGQIASAIQSIVTRAMRVVGGIPSLLIGLTVTVF
1950|gene|hla      DVEAIETELAALTGEQIEVGEVLTTVGQVLANTL---FGGLGGIVTTALRASVGLSLALF
65307|hp|hma       QLDILESRIKGLTGVEVDIAGELVSSGRDIGTII---VERSTQAFSTITFHLIGIALALF
                   ::  :*  :   **  :::     :    :.. :                  :*:::::*

940|gene|hla       VLFALLRDGEQLVAWVQWVLPVDEDILDELREGLDQLMWASVVGNVAVAAIQAALLGVGL
1894|gene|nph      VLFALLRDRGKLLAWLYRVLPVDDGVQQELFRELDRLMWASVVGNVAVAAIQAVLLGVAL
1950|gene|hla      LVYYTLLDGPAFVRWLRQTSPLPADVTSDLVDRVDAMTRGVVIGHIVVALLQALVAGLGL
65307|hp|hma       LIYYLLKDGDDLVDWLHRTVPLPVDVQRDFYAEIDDVMLGVLFGHVFVAIVQGIVAGVGL
                   :::  * *   :: *: .. *:  .:  ::   :* :  . :.*:: ** :*. : *:.*

940|gene|hla       AIAGLPAVIFLTVVTFVLTLLPLVGAFGVWVPAAMYLLAVGRPIASAAIAVYGLLV-TFS
1894|gene|nph      VLLDVPVVVFLTVTTFVLSLLPLVGAFGVWVPVSVYLAVADRPTAAALLVVYGSLV-SLS
1950|gene|hla      WAAGIPNVVFWTFVMAVLALVPLVGAFFVWGPAAAYLVAIDQVTAGVFLAIYGVLVIAMV
65307|hp|hma       AATGVPNAMFWTAVMVVLAMVPLIGTIPVWGGAVIYLYATDEPLLAVGLFLYSVIIVGLT
                      .:* .:* * .  **:::**:*:: **  .  ** . .    .. : :*. ::  : 

940|gene|hla       DTYLRPALIGRTGAFNSAIIVIGIFGGLVVFGAVGLFIGPVVLGGAKLVLDCFAREH---
1894|gene|nph      DNYFRPALIGRSGALNPAIIVVGIFGGIVAFGAVGLFIGPVVLGGAKVTLDVFARERAAA
1950|gene|hla      DNYARPIVIDQQAHLNPAVILLGVFGGIYSIGFTGLFVGPIVIGVLAATLETFREDY---
65307|hp|hma       DDYLRPFAVDRYAKLNPAVILLGILGGAYAFGVMGLLFGPVVLGALKAALRVGLDTW---
                   * * **  :.. . :*.*:*::*::**   :*  **:.**:*:*    .*          

940|gene|hla       --------------TGEPTA----------------------------------------
1894|gene|nph      TGRTAPEWDGDDAVAGSPTDGDAANSGNDGEQGEGAADDADAGGEGDADGEAAASTATDA
1950|gene|hla      -----------DLI----------------------------------------------
65307|hp|hma       -----------SQIDDGNIG----------------------------------------
                                                                               

940|gene|hla       -----------
1894|gene|nph      GDEADDNDDRA
1950|gene|hla      -----------
65307|hp|hma       -----------