HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0276arCOG02976hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0276 nrc1 VNG2524 vng2524 no entry
nucHOG0276 hmu HMUK0220 Hmuk_0220 conserved hypothetical protein
nucHOG0276 hma RRNAC2224 hypothetical protein
nucHOG0276 hwa HQ1062A hypothetical protein
nucHOG0276 hla HLAC1909 Hlac_1909 hypothetical protein
nucHOG0276 hbo HBOR03880 Hbor_03880 hypothetical protein
nucHOG0276 hut HUTA0969 Huta_0969 conserved hypothetical protein
nucHOG0276 hvo HVO_1819 HVO_1819 conserved hypothetical protein
nucHOG0276 nph NP1708A hypothetical protein
nucHOG0276 hhi 2696 HAH_2696 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1062|hp|hwa       MNSADENDSEIEED-------------NVTQDENHDRGHHEEQMTEQDVT---------T
1909|hp|hla       --MNESTDPASDKG-------------SDAADGTTDTTAEPS-----EPS----------
3880|hp|hbo       MTDDDRTTP--DRNGRSDADPDATTGSTEDAAETPQDGERPGAIDRDEPRPTDGDASADA
1819|hp|hvo       --MTDESDE------------------FETGASDAEETARPDA----DPR----------
969|chp|hut       --MDDRSPP--ADE-------------EEPTDGSSSPTEDVT-----DPA---------A
12224|hp|hma      --MTEGAPP--DET-------------DVEAADDGSAGHQPD-----DPA----------
2696|hp|hhi       --MTEGAPP--DET-------------DVEAADDGSAGHQPD-----DPA----------
2524|hp|nrc1      -MPDQRPSP--DEW-------------DA------------------EPV----------
1708|hp|nph       MDDDARTAP--DDD-------------ALGADAE-------------APT----------
                                                                              

1062|hp|hwa       QANPTDNESDDHNSATTVSNTPSDTQADMTETQTVPSTEADDEMNASGQSSPPDVAKYAR
1909|hp|hla       ---EPANESRSGADESGALDGDESAVSDGDTGDAASNGDGNAEQ------VPPEVRKYER
3880|hp|hbo       EDIESVDATDSEGDDGAGATDAESTDAESTNEKSTDADGTNGESTDEEPEIPRDVQKYAR
1819|hp|hvo       ---AAADEAAGDTEPVDPATDSETAGAEPRDDAGADADDA----------VPEDVQKYAR
969|chp|hut       SANRPADQRDATADAVDNAKDPTEADDPIDRSDETGASTAEGETDED---VPADVRSYER
12224|hp|hma      --AADDGADDGETTESGPADSATEGTAPAEPTSGTAVSEASD--------VPSDVQKYDR
2696|hp|hhi       --AADDGADDGETTESGPADSATEGTAPAEPTSGTAVSEASD--------VPSDVQKYDR
2524|hp|nrc1      --AVPVDHGDGESDTTEP---------------------------------PADVRTYDR
1708|hp|nph       EDGPDGEQSDSAGTEADPAED-----------------------------VPKDVQEYTR
                                                                     * :*  * *

1062|hp|hwa       FKKVDGAQYDRVNNFLRDRTYITAREWAIARLCSDFRTETGVEMTKIGTNLPQLVPFMTD
1909|hp|hla       FKKMDGARYERVNEFLRDRTYITAREWAIARLCADFRTETGVEMTKIGENLPELVPFMTD
3880|hp|hbo       FKKMDGAQYDRVNEFLRDRTYVTAREWAIARLCADFRTETGVEMTKIGENLPELVPFMTD
1819|hp|hvo       FKKVDGAQYDRVNDFLRERTYVTAREWAIARLCADFRTETGVEMTKIGNNLPELVPFMTD
969|chp|hut       FQKIDGGTYERANDFLRERTYITAREWAIARLCADFRTETGVEMTKIGENLPELVPFMTD
12224|hp|hma      FKKIEGGTYDRANDFLRDRTYITAREWAIARLCADFRTETGVEMTKIGENLPELVPFMTD
2696|hp|hhi       FKKIEGGTYDRANDFLRDRTYITAREWAIARLCADFRTETGVEMTKIGENLPELVPFMTD
2524|hp|nrc1      FSKMDGAQYDRVNDFLRERTYITAREWAIARLCADFRTETGVEMTKIGRNLPDLVSFMTD
1708|hp|nph       FSKIDGATYDRANEFLRDRTYITAREWAIARLCADFRTETGVEMTKIGENLPELVPFMTD
                  *.*::*. *:*.*:***:***:***********:************** ***:**.****

1062|hp|hwa       TYTPQAVNQARSSFEEKVTKAGATFLYGAMSGFFTADELDKLMYEVTETAKFLLEVEGVD
1909|hp|hla       TYTPQAVNQARYSFEEKVTKAGATFLYGAMSGFFTAEDLDEMMYEVTEVAKFLLEVEGVD
3880|hp|hbo       TYTPQAVNQARSSFEGKVRKAGATFLYGAMSGFFTAEELDELMYEVSEVAKFLLEVEGVD
1819|hp|hvo       TYTPQAVNQARSAFRDKVRKSGATFLYGAMSGFFTAEELDEMMYEVTEIAKFLLEVEGVD
969|chp|hut       TYSPQAVNQARASFEEKVRMAGATFLYGAMSDFFTADELDDLMYEATEVAKFLLEVEGVE
12224|hp|hma      TYTPQAVNQARAAFEDKVRKAGATFLYGAMCDFFTAEDLDDVMYEATEVAKFLLEVEGVD
2696|hp|hhi       TYTPQAVNQARAAFEDKVRKAGATFLYGAMCDFFTAEDLDDVMYEATEVAKFLLEVEGVD
2524|hp|nrc1      TYSPQAVNQARASFEEKVELAGATFLYGAMCDFFTADELDDLMYEVTEVAKFLLEVEGVD
1708|hp|nph       TYSPQAVNQARSSFDEKVRKAGATFLYGAMCDFYTAEELDELMYEVTEIAKFLLEVEGVE
                  **:******** :*  **  :*********..*:**::**.:***.:* **********:

1062|hp|hwa       LSVADELEAEDRISTVMREVREASDDLRTTENVDADTDADTSTESGSHSH
1909|hp|hla       LAVADELEAEDRISEVMREVRASSADLRGEEVRCPECGHVHEPAEE----
3880|hp|hbo       LSVEEELEAEERISSVMREVRDASEDLRREELADEASDD-----------
1819|hp|hvo       LSVEEELEAEERISSVMREVREASTELRQEELSDEE--------------
969|chp|hut       LSVGEELEAEDRISEVMREVRDQSVALRHDEAECPECGHTFEVAVDE---
12224|hp|hma      LAVEDEMEAEDRISSVMREVREQSAALRHDEVCCPECGNEFQVDE-----
2696|hp|hhi       LAVEDEMEAEDRISSVMREVREQSAALRHDEVCCPECGNEFQVDE-----
2524|hp|nrc1      LAVDDELAAEERISSVMRDVRAASDALRHDGVECPNCGHTIEHGG-----
1708|hp|nph       LTVDEELAAEDRISSVMREVRESSAALRHDELQCPNCGHEMETQDD----
                  *:* :*: **:*** ***:**  *  **