HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0275COG4801arCOG02471hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0275 nrc1 VNG0507 vng507 no entry
cHOG0275 hmu HMUK2812 Hmuk_2812 conserved hypothetical protein
cHOG0275 hma RRNAC0234 hypothetical protein
cHOG0275 hwa HQ2627A hypothetical protein
cHOG0275 hla HLAC1784 Hlac_1784 hypothetical protein
cHOG0275 hbo HBOR16110 Hbor_16110 predicted acyltransferase, COG4801
cHOG0275 hut HUTA1484 Huta_1484 protein of unknown function DUF583
cHOG0275 hvo HVO_1610 HVO_1610 conserved hypothetical protein
cHOG0275 nph NP1670A hypothetical protein
cHOG0275 hhi 981 HAH_0981 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


507|chp|nrc1      MPMRRLDCGVLGPTPIDQLHIPDGTTVKEHDVVADSDVLIGAQSQLRLGVRGHNVVAGER
1670|hp|nph       ---------MFGPDPLDELAIPDGTHVREHDLVTDGDVLVGGQSVVELGVRGSNIVAGER
1484|hp|hut       --MDFTDRDVLRSTPLEELVIPDGTTVEEHDLVTDSDVIVGGQSTVEFGVRGNNVIAGER
2627|hp|hwa       -MRLVLKSVSFGNDPFDSLTIPDGTTVEEYDLVTEGNVMIGGQSTVEFGVRARNILAGER
10234|hp|hma      MNETAIETVPLGSDPLSELDIPDGTTVEEHDLVTDGDVIVGGQSTVEFGVRGRTVIADER
981|hp|hhi        --------MPLGSDPLSELDIPDGTTVEEHDLVTDGDVIVGGQSTVEFGVRGRTVIADER
1784|hp|hla       -------MSLRGGGPIEELAVPSGTTVEEHDLVTDGDVLVGSQSTVEFGLRGRNVALGER
16110|hp|hbo      --------MSLGSDPLDALEIPDGTTVEEHDLVTDGDVIVGGQSTVEFGVRGRNVFAGER
                                *:. * :*.** * *:*:*::.:*::*.** : :*:*. .:  .**

507|chp|nrc1      VSVDGDIEAAGDCRLDMWCEVTGNVLVEGDAYVGERTHITERLVVGGDLDIGDDVDIEEG
1670|hp|nph       VQFGGDIEADGDCRLDMWCEVDGNVLVGEDAYLGERVHITGQLIVSGDLDIGDDVDIEEG
1484|hp|hut       TRFEGHIEAEGDCRLDMWCDVAEDVLVGEDAYLGERVHIGGELKVAGDLDIGDDVDIDEG
2627|hp|hwa       VQFGGSIEAERDCRLDVWCEVADNVLVGKDAYLGERVHIGGQLLVAGDLDIGDDVTVEEG
10234|hp|hma      VRFGGHIEAEGDCRLDMWCDVADNVLVGEDAYIGERVHIGGELRVAGDLDIGDDVDIENG
981|hp|hhi        VRFGGHIEAEGDCRLDMWCDVADNVLVGEDAYIGERVHIGGELRVAGDLDIGDDVDIENG
1784|hp|hla       VSVENDIEAEGDCRLDTWCSVDGNVLVGEDAYLGERVTVTGRLMVSGDLDIGDDVTIEEG
16110|hp|hbo      VQFGGDIEAEGDCRLDVWCDVAGNVLVGQDAYLGERVHVGGRLMVSGDLDIGDDVDIEEG
                  . . . ***  ***** **.*  :***  ***:***. :   * *.********* :::*

507|chp|nrc1      FEASGWIVIRNPMPTLTFFVMYLTHLLRLGEAEDAQELVEELA--ADSDRGP--------
1670|hp|nph       FEANGWIVIRNPMPTIVFLFVYLSHLLRMGDEEAAEEVAEEFLT-DDQAADP--------
1484|hp|hut       FEANGWIVIRNPMPTIVFLFVYLSHLLRIGEEDTAEDVLAAALD-ADREAQP--------
2627|hp|hwa       FEANGWIVIRNPVSSLVFYFIILSHLLQVNESEAASEFVQEIAAEAENNTDDADTDSNDV
10234|hp|hma      FEANGWIVIRNPMPTIVFLFVYLSQLLRIGEEDAAEEVIDEMLDDGSDEHDP--------
981|hp|hhi        FEANGWIVIRNPMPTIVFLFVYLSQLLRIGEEDAAEEVIDEMLDDGSDEHDP--------
1784|hp|hla       FEANGWIVIRNPVPTLVFYFIVLSQLLRLGETDAADNLAEALAD-GEDVRDP--------
16110|hp|hbo      FEASGWIVIRNPVPTLVFYFVVLSQLLRLGENEAADELAESLS--GESEVDP--------
                  ***.********:.::.* .: *::**.:.: : *.:.        .             

507|chp|nrc1      --LTIPQSASVSDDAWRVSTPATIGDDCRLHGNIRATEIDVGRGNNVFGSLRAQNDVTVG
1670|hp|nph       --VVIPRGGRVSDDAWRVSTPATIGDDCRLHGNIRATDIEVGTATEVFGSLRAKGDIRIG
1484|hp|hut       --LLVPRGTHVSDDAWRVSAPARIGDDCRLHGNLRAESLTVGRDTTVFGSLRAKNDLTVG
2627|hp|hwa       MMIVIPRGATVSDDIWQVSTPASIGDDCRLHGNVRAASITVGCDTNLFGSLRARGDIDID
10234|hp|hma      --VLIPRGASVSDDAWRVSTPATVGDDCRLHGNIRAKSLEVGRDTVVFGSLRAKDDIVVG
981|hp|hhi        --VLIPRGASVSDDAWRVSTPATVGDDCRLHGNIRAKSLEVGRDTVVFGSLRAKDDIVVG
1784|hp|hla       --LLVPRSAEISDDAWRVSTPASVGDDCRLHGNLRAESIRVGERNEVFGSLRAREGITVG
16110|hp|hbo      --LVVPRGSTVSDDAWQTSAPAHIGDDCRLHGNVRAESITVGSDNNVFGSLRARGDITVG
                    : :*..  :*** *..*:** :*********:** .: **  . :******. .: :.

507|chp|nrc1      AGTKIHGDVTTRNGSVHVQGDAVVLGDVSGHDVTIDEAADVDGVIRARGEMRV-------
1670|hp|nph       DDTVVHGDVTTKDGDVAVAPGVRIRGDISCEACTLSEAADVEGTIRARDGIEFERER-SP
1484|hp|hut       RASEIKGDVTTRNGTVSIGPGVHVWGDISAENVALHENATVDGTIRASNEMRMHTNS-VL
2627|hp|hwa       KRTRIHGDVTTRNGAVSISAGARIRGDVVCDNLQLHDDAEVYGTIRASGEVNIVHAP-IA
10234|hp|hma      RGTEIKGDVTTRSGTVRVGPGAKVWGDISGTTVELHENATVDGTIRASEEMRMHTET-VL
981|hp|hhi        RGTEIKGDVTTRSGTVRVGPGAKIWGDISGTTVELHENATVDGTIRTSEEMRMHTEA-VL
1784|hp|hla       ADTTIHGDVTTRGGTVTVEAGARVLGDVSAGDLVVHDGAEIDGTLRARGEMKLVQETGDG
16110|hp|hbo      SGTRIHGDVTTRNGTVAIEGDARILGDVSCAELELNENAAVDGTMRAKGDMRIVR-----
                    : ::*****..* * :  .. : **:      : : * : *.:*:   : .       

507|chp|nrc1      ------------------------------------------------------------
1670|hp|nph       SG-ERGRGAVASGHETTETEAEPEDSPDEPAAKPATDEQATDADRGGAAADDDPGTGSES
1484|hp|hut       EDVDEAAEAMAAVADNLDAVETGETDASEHEQQAATEPNADEVDPLEQPTATESGSETDA
2627|hp|hwa       DE----------------------------------------------------------
10234|hp|hma      DRPDESAAAMAEMAESLEADTDTTEPAIERSDSDDTEPAADTAD--------DNSATVDS
981|hp|hhi        DRPDESAAAMAEMAESLEADTDTTEPADERSDSDNSESAADAAA--------DDPATADS
1784|hp|hla       DEGEGETESDDAGEDEGDADEIGETDADELSDEDGTSDGDDSAD------------GEES
16110|hp|hbo      ------------------------------------------------------------
                                                                              

507|chp|nrc1      ----------------------------------------------------------GS
1670|hp|nph       PEESTPDAAADGSEQPEADDESHERSAAFVPLDTTEPKPAVRSLEEARHDWTDGQGDTTG
1484|hp|hut       ADE-------------------------------------------------DGAVGAGA
2627|hp|hwa       ------------------------------------------------------------
10234|hp|hma      ATT-------------------------------------------------DDGDIDGA
981|hp|hhi        AAT-------------------------------------------------DGGDADGA
1784|hp|hla       DSD-------------------------------------------------ESGVEESD
16110|hp|hbo      -----------------------------------------------------------S
                                                                              

507|chp|nrc1      VADRDAE-----------------------------
1670|hp|nph       DGAADTEADDHSDPTTNGVGDDDVSAVVTDTEES--
1484|hp|hut       DEASEQQEATTPTAETDAADDDDAQGSGGDASETPD
2627|hp|hwa       ------------------------------------
10234|hp|hma      TS-SDTSEDSPDVEEAAESAE---------------
981|hp|hhi        TTGSDASEDGPDVEEAAESAE---------------
1784|hp|hla       SGGSDVESPDTEEPDVDAEAT---------------
16110|hp|hbo      DASRDIE-----------------------------