HOG Organism Gene ID Name Annotation
aHOG2747 hmu HMUK2978 Hmuk_2978 conserved hypothetical protein
aHOG2747 nph NP2552 hypothetical protein
aHOG2747 hma Hma_13142 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2552|hp|nph       ----MGGLLPRLAEREREVWIAALLLYGVGDTVTTFWGLSLGGVAEAGPIARPLIDAYGR
13142|hp|hma      MNWRHPARFAGPSNTAVALWAVAVAFFGVGDLVTTLIGYSITGVTELSPVVKLLLEEHAV
                        . :.  ::    :* .*: ::**** ***: * *: **:* .*:.. *:: :. 

2552|hp|nph       GALIGIKVVVFPTFYVVWRLLRTPGRVAVPLALAVVGAAVTLWNLVVISGAL--
13142|hp|hma      LVLTGLKATVFVGFFAVWKYVSRPYSIGVPLGLALLGVAVTAWNTGIILTAVLA
                   .* *:*..**  *:.**. :  *  :.***.**::*.*** **  :*  *: