HOG Organism Gene ID Name Annotation
aHOG2734 hmu HMUK2213 Hmuk_2213 NUDIX hydrolase
aHOG2734 nph NP2056 ADP-ribose pyrophosphatase, GDP-mannose mannosyl hydrolase
aHOG2734 hma Hma_10995 mutT6 Mut/nudix family protein
MUSCLE (3.6) multiple sequence alignment


2056|gene|nph       MPSPSALLDRYESPIHKRDTIELSADRYEAGIE----RGDDG-AWGVGALVV-SAGRVLF
10995|gene|hma      MPTLADFADR---DVHTR---RVTRETDTAGVDGVRARADRGLRWAVGALVTDPADRLLF
                    **: : : **    :*.*    :: :   **::    *.* *  *.*****. .*.*:**

2056|gene|nph       VREGETWLLPGGKLHADESVEAGARREVREETGIDIELSTLGAVAEQTFRHPERDDSYQF
10995|gene|hma      VYEDDIWKLPGGGVETGETRQEAVCREVREETGVRIAVDELAAVTEVTVTDGDRKAT--F
                    * *.: * **** : :.*: : .. ********: * :. *.**:* *.   :*. :  *

2056|gene|nph       YFATF--VAEPRPPEPEPTAAAEAVDEAAWLQSVPESTFDRELVVRLVERYSGSEAKAHP
10995|gene|hma      FFGTYRGTADATALASDPGLDGESIETVTWRDSVPENCLDESLVRRLR------------
                    :*.*:  .*:. .  .:*   .*::: .:* :****. :* .** **             

2056|gene|nph       FQGCG
10995|gene|hma      -----