HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0273COG2021arCOG00627Homoserine acetyltransferasehomoserine O-acetyltransferase

HOG Organism Gene ID Name Annotation
cHOG0273 nrc1 VNG2420 metA homoserine O-acetyltransferase
cHOG0273 hmu HMUK1097 Hmuk_1097 homoserine O-acetyltransferase( EC:2.3.1.31 )
cHOG0273 hma RRNAC3064 metA homoserine O-acetyltransferase
cHOG0273 hwa HQ3700A metA homoserine O-acetyltransferase
cHOG0273 hla HLAC2550 Hlac_2550 homoserine O-acetyltransferase
cHOG0273 hbo HBOR02450 Hbor_02450 homoserine O-acetyltransferase( EC:2.3.1.31 )
cHOG0273 hut HUTA2620 Huta_2620 homoserine O-acetyltransferase
cHOG0273 hvo HVO_2998 HVO_2998 metX homoserine O-acetyltransferase
cHOG0273 nph NP0282A metA homoserine O-acetyltransferase
cHOG0273 hhi 320 metA homoserine O-acetyltransferase
MUSCLE (3.6) multiple sequence alignment


2420|gene|nrc1      MAAALAVIAVHNTVAKNYYQVCTDGGPMPTTELDGFTFACGDTVDSLTVAYRTYGDYTGS
2550|gene|hla       -----------------MSTVPTDHG---VAALGEFVFECGQSVPDLEVAYETHGEFDGD
3700|gene|hwa       --------------------MKSESG---TASLGRFDFACGDEIESLEVAYEAYGEFNGD
2450|gene|hbo       --------------------MKTESD---TVELGAFDFECGAEIPSLEVAYEAYGEFDGD
282|gene|nph        ---------------------MSEQQ---TASLGEFTFECGESIPDLELAYETYGEFTGD
13064|gene|hma      --------------------MNVEHN---TVSLGEFEFDCGETIPELEITYEAYGEFDGD
320|gene|hhi        --------------------MNVEHN---TVSLGEFEFDCGETIPDLEITYEAYGEFDGD
2620|gene|hut       ------------------MTVTAEHE---TVSVGEFEFECGESIPELEIAYEAYGEFEGD
                                           :     .. :. * * **  : .* ::* ::*:: *.

2420|gene|nrc1      NAVLVCHALTGSQHVR---------GR------ADGDDRGWWPDIVGPGRPIDTTEYFVV
2550|gene|hla       NVVLVCHALTGSQNVARSPAPERNEGTRGAG--QAGQARAWWDDIVGPGKAIDTTKYYVV
3700|gene|hwa       NAVLLCHALTGSQNVA---------GYTDEE--TDGQARAWWNDIVGPGKAIDTTEYYVV
2450|gene|hbo       NAVLVCHALTGSQNVA---------GY-GTE--TAGQARAWWNDIVGPGKAIDTNEYYVV
282|gene|nph        NAVLVCHALTGSAHVA--------GGRRRSD--TSGQAHAWWDDIVGPGKAVDTTDYYVI
13064|gene|hma      NAVLVCHALTGSAHVA---------GRDRVD--SADQARAWWDDIVGPGKAIDTTEYYVV
320|gene|hhi        NAVLVCHALTGSAHVA---------GRDRVD--SADQARAWWDDIVGPGKAIDTTEYYVV
2620|gene|hut       NAVLICHALTGSAHVA---------AHPDADDATSGQARAWWDDIVGPGKAIDTTEYYVI
                    *.**:******* :*          .         .: ..** ******..:**..*:*:

2420|gene|nrc1      CANVPGSCHGTDGPPADGPG---------GDPWGTAFPPVTVPDWTRCQRRLLDTLGVDR
2550|gene|hla       CANVPGSCYGTTGPASERPADLDLPEEPDHDRWGTAFPPVQVEDWARSQRRLLDHLGVGR
3700|gene|hwa       CANVPGSCYGTTGPASTDPE---------GEVYATDFPPVTVQDWTRAQRQVLDTLGVGR
2450|gene|hbo       CANVPGSCYGTTGPASESPD---------GEPYGTDFPPVTIGDWTRAQRRLLDELGVGR
282|gene|nph        CANIPGSCYGSSGPPSTNPE--------TGEPWGTTFPAVTVGDWTRAQRRLLDHLGVPH
13064|gene|hma      CANVPGSCYGSTGPKSENPE--------TGEPYGTDFPPVTVTDWTEAQRALLDELGIPH
320|gene|hhi        CANVPGSCYGSTGPKSENPE--------TGEPYGTDFPPVTVTDWTEAQRALLDELGIPH
2620|gene|hut       CANVPGSCYGTTGPASTNPE--------TGEPYGTDFPPVTVSDWTEAQRKLLDELGVPH
                    ***:****:*: ** :  *           : :.* **.* : **: .** :** **: .

2420|gene|nrc1      LHAVVGGSVGGMNALDWARRYPDDVHRIAAVATAPRLDAQCLGLNAIARRAIRGDPNWND
2550|gene|hla       LRAVVGGSVGGMNVLEWAKRYPDDVDRVVAIATAGRLDAQCLALDAVARRAIRADPNWNG
3700|gene|hwa       LHAVAGGSVGGMNALDWARQYPDDAECIIAVAAAPRLDAQSLALDAIARRAITTDPNWND
2450|gene|hbo       LHAVVGGSVGGMNALDWVRRYPDDVRYLLAVATAGRLDPQCLALDAIARRSITTDPNWNG
282|gene|nph        LHAVVGGSVGGMNVLDWAKRHPDHVNRVAVVAAAARLDPQCLALDAIARRAITTDPNWNG
13064|gene|hma      LHAVVGGSVGGMNVIEWAKRHPDHVDRIVPIAAAARLDTQCLSLDAIARRAITTDPNWKQ
320|gene|hhi        LHAVVGGSVGGMNVIEWAKRHPDHVDRIVPIAAAARLDTQCLSLDAIARRAITTDPNWNQ
2620|gene|hut       LHAVVGGSVGGMNVLEWAKRHPDHVDRIAPIAASARLDTQSLALHGIKRRAITGDPAWDG
                    *.**.********.::*...:** .  :  :*:: ***.*.*.* .: **:*  ** *. 

2420|gene|nrc1      GDYYGGA--HPDRGLALARQLGHVMYLSKASMADKFGRRTATTDT--------ALPADPA
2550|gene|hla       GNYYGEGRPSPDEGLALARQIGHIMYLSKASMERKFGRRSAGRDSLTREEGDLGLPPEPT
3700|gene|hwa       GDYYDAET-TPTDGLAIARQIGHVMYLSKSSMQQKFARRAAGRDA-----RRDSFPVDPA
2450|gene|hbo       GDYYDSE--PPDDGLALARQLGHVMYLSKSSMERKFGRRAAGRDA-----RRDSFPADPA
282|gene|nph        GDYYGED--PPVEGLALARQIGHVMYLSKSSMQDKFGRRSSGIDA-----GRDSFEMDPA
13064|gene|hma      GHYYGEDDEPPSDGLALARQLGHVMYLSKASMERRFGRRAAGRDA-----VR-TFPTDAA
320|gene|hhi        GHYYGEDQDPPSDGLALARQLGHVMYLSKASMERRFGRRAAGRDA-----VR-TFPTDAA
2620|gene|hut       GDYYGEEHPNPTDGMALARQIGHVMYLSKASMDRKFGRRSAGRDA-----HR-SFPEEPA
                    * **.     *  *:*:***:**:*****:**  .*.**::  *:         :  :.:

2420|gene|nrc1      AEFFATRDVESYLDYQADTFVARFDANSYLYLLRAMDAYDLAAGRPSVADALAAFDGDAL
2550|gene|hla       AAFFPYREVESYLDYQAEGFSERFDANSYLYLTRAMDEYDLSAGHGTDADALAAFEGEAL
3700|gene|hwa       AAFFPYRDVESYLDYQAEKFVDRFDPNSYLYLTRAMDDYDLAEGYEDDARAIAAFEGETL
2450|gene|hbo       ASFFAYRDVESYLDYQAEKFVDRFDANSYLYLTRAMDDYDLAEGYEDDADAVAAFEGEAL
282|gene|nph        AGFFPYREVESYLDYQGEKFARRFDANSYLYLTRAMDNYDLASGYESDRDALAAFDGEAL
13064|gene|hma      GAFFPYRDVESYLDYNAEKFTERFDANSYLYLTRAMDNYDLAAGFESDADALAAFDGDAL
320|gene|hhi        GAFFPYRDVESYLDYNAEKFTERFDANSYLYLTRAMDNYDLAAGFESDADALAAFDGDAL
2620|gene|hut       ASFFPYRDVESYLDYQAEKFVGRFDANAFLTMTRATENYDLAAGFESDADALAAFDGEAL
                    . **. *:*******:.: *  ***.*::* : ** : ***: *      *:***:*::*

2420|gene|nrc1      VLSFTGDWHFTAAQSATVADAFRAGGAAGVAHHVVDSDYGHDAFLVDSAAVGPPLADFLA
2550|gene|hla       LMSFTADWHFTVEQSSSLAAAFRDRD-VPVAHHVIDSDHGHDAFLVEPEHVGPPLRDFLV
3700|gene|hwa       LISFTGDWHFTTEQSEALAEAFRSVS-TPVAHHVIESDHGHDAFLVEPDKVGPPLRDFLA
2450|gene|hbo       LLSFTGDWHFTTEQAESLAESFRDTS-VPVAHHVIESDHGHDAFLVEPEKVGPPVRDFLD
282|gene|nph        LISFTGDWHFTVEQSEAVADAFRESG-TDTAHHVVDSDHGHDAFLVEPDRVGPPLDDFLV
13064|gene|hma      VMSFTADWHFTTQQAEALADSLRAAD-ANVAHHVIDSDHGHDAFLVEPDNVGPPLADFLD
320|gene|hhi        VMSFTADWHFTTQQAEALADSLRAAD-ANVAHHVIDSDHGHDAFLVEPDNVGPPLADFLD
2620|gene|hut       VMSFTSDWHFTVAQAESLADSLRDAT-VGTAHHVIESDHGHDAFLVEPENVGPPLADFLK
                    ::***.*****. *: ::* ::*    . .****::**:*******:.  ****: *** 

2420|gene|nrc1      AGTDGAAVTDA--TGGV-------------------
2550|gene|hla       EGVGGRAVSDDGGGGGNDSARPERDHAPVHASLFKG
3700|gene|hwa       DGINGRAVHDT--ADSNADN--DSGFAPVHASLFSQ
2450|gene|hbo       AGVAGRSVHDT--VEEVEEPSVERDFAPVHTSLFSR
282|gene|nph        DGVAGKAVSDT--TPDDDD---GDEFAPVHTSLFSD
13064|gene|hma      AGVDGNAVTDS--V--VEDSQ-ESNFAPVHNSLFSQ
320|gene|hhi        AGVDGNAVTDS--V--VEDSQ-ESNFAPVHNSLFSQ
2620|gene|hut       DGVAGSAITDT--SNDAEEST-DSDFAPVHTSLFSR
                     *  * :: *