HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0272COG1933arCOG03147/3Archaeal DNA polymerase II large subunitDNA polymerase type II large chain

HOG Organism Gene ID Name Annotation
cHOG0272 nrc1 VNG2338 polD2 DNA polymerase type II large chain
cHOG0272 hmu HMUK0763 Hmuk_0763 DNA polymerase II, large subunit DP2( EC:2.7.7.7 )
cHOG0272 hma RRNAC2691 polA2 DNA polymerase II large subunit
cHOG0272 hwa HQ3461A polA2 DNA polymerase II large subunit
cHOG0272 hla HLAC0150 Hlac_150 DNA polymerase II, large subunit DP2
cHOG0272 hbo HBOR01600 Hbor_01600 DNA polymerase type II, large subunit( EC:2.7.7.7 )
cHOG0272 hut HUTA1619 Huta_1619 DNA polymerase II, large subunit DP2
cHOG0272 hvo HVO_0065 HVO_0065 polC DNA polymerase II large subunit DP2
cHOG0272 nph NP0476A polA2 DNA polymerase II large subunit
cHOG0272 hhi 3092 polA2 DNA polymerase II large subunit
MUSCLE (3.6) multiple sequence alignment


2338|gene|nrc1      MRPTDETYFETLETGLDDAFEVAEAARERGEDPTPNVEIPVAKDMADRVENILGIDGVAE
1619|gene|hut       MRDADERYFARLEDELDTAMDVARSARERGGDPTTDVEIPVAKDMADRVENILGIDGVAE
12691|gene|hma      MREADEQYFETLETQLEAAFDVAERAKERGGDPKPEVEIPTARDMADRVENILGIDGVAE
3092|gene|hhi       MREADEQYFETLETQLEAAFDVAERAKERGGDPKPEVEIPTARDMADRVENILGIDGVAE
3461|gene|hwa       MRDADKQYFETLESHLEQAFARARQAKGQGYDPKPEVEIPVARDMADRVENILAIPDVAE
476|gene|nph        MREDDEQYFRRLESDLDTALSVAREARKRGGDPTEDIEIPIAKDMADRVENILGIDGVAE
150|gene|hla        MRPDDERYFAQIEDRLDEAWDVAEAAKEQGHDPKPKIEIPIARDMADRVENILGIDGVAE
1600|gene|hbo       MHEDDERYFARIEDRLDEAFDLARAAKGQGRDPQPEVEIPVAKDMADRVENILGIPGVAE
                    *.  *: **  :*  *: *   *  *. .* **  .:*** *.**********.* .***

2338|gene|nrc1      RVRDLDG--EMSREEAALELVADFVDGRVGDYDTDAGKIEGAVRTAVALLTEGVVAAPIE
1619|gene|hut       RVRDLEG--EMSREEAALALVEDFVAGTVGDYDTKAGKIEGAVRTAVALLTEGVVAAPIE
12691|gene|hma      RVRELEG--QMSREEAALELVEDFVEGTVGDYDSREGKVEGAVRTAVALLTEGVVAAPIE
3092|gene|hhi       RVRELEG--QMSREEAALELVEDFVEGTVGDYDSREGKVEGAVRTAVALLTEGVVAAPIE
3461|gene|hwa       RIRELDD--ERSREEVALELVTDFVEGTVGDYDTREGKIEGAVRTAVALLTEGVVAAPIE
476|gene|nph        RVREMEADPDLSREEAALELAADFANDEVGDYETRAGKVEGAVRTAVALLTEGVVAAPIE
150|gene|hla        RVRELEG--EMSREEAALELVTDFVEGTVGDYDSRAGKVEGAVRTAVALLTEGVVAAPIE
1600|gene|hbo       RVRELEG--QMSREEAALELVNDFVEGSVGDYDSRAGKVEGAVRTAVALLTEGVVAAPIE
                    *:*:::   : ****.** *. **. . ****::  **:*********************

2338|gene|nrc1      GIDRVEVNDNDDGTQYVAVYYAGPIRSAGGTAQALSVLVADYARAMLGIDAFKPRDDEIE
1619|gene|hut       GIDRVEILDNDDGTQFVNVYYAGPIRSAGGTAQALSVLVADYARTLLDIDEYHARDEEIG
12691|gene|hma      GIDRVELLENDDGTEFINVYYAGPIRSAGGTAQALSVLVADYARALLGIDQYKAREEEIG
3092|gene|hhi       GIDRVELLENDDGTEFINVYYAGPIRSAGGTAQALSVLVADYARALLGIDQYKARDDEIG
3461|gene|hwa       GIDRVEILSDDDGSEFVNVYYAGPIRSAGGTAQALSVLVADYARSLLDIDEYSARTDETE
476|gene|nph        GIDRVELLENDDGTEFINIYYAGPIRSAGGTAQALSVLVADYTRTLIGIDEYKARNDETE
150|gene|hla        GIDRVELLENDDGTEFVNVYYAGPIRSAGGTAQALSVLVADYARSLLDIDEYKPRDVEVE
1600|gene|hbo       GIDRVEILENDDGTEFVNVYYAGPIRSAGGTAQALSVLVADYARSLLGIEEYKARDIEVE
                    ******: .:***:::: :***********************:*:::.*: : .*  *  

2338|gene|nrc1      RYAEEVDLYDSETGLQYSPKDAETTFITEHCPVMLDGEATGNEEVDGFRDLERIDTNSPR
1619|gene|hut       RYVEEIELYDEDTGLQYSPKEKETRHITDHMPIMLDGEATGGEEVSGYRDLERVDSNSAR
12691|gene|hma      RYAEEIDLYDKDTGLQYSPKEKETKFIAEHMPIMLDGEATGDEEVSGYRDLERVDSNSPR
3092|gene|hhi       RYAEEIDLYDKDTGLQYSPKEKETKFIAEHMPIMLDGEATGDEEVSGYRDLERVDSNSPR
3461|gene|hwa       RYAEEVSLYDRETGLQYSPKDKETKFITKHMPIMLDGEATGNEEVSGYRDLERVDTNAAR
476|gene|nph        RYAEELSLYDDETGLQYAPKDEETKFIAEHMPIMLDGEATGDEEVSGFRDLERVDTNSAR
150|gene|hla        RYAEEISLYDKETGLQYSPKDKESKFIAQHMPVMLDGEATGDEEVSGFRDLERVDTNSAR
1600|gene|hbo       RYAEEIDLYDKETGLQYSPKDKETKFIAEHMPIMLDGEATGDEEVSGFRDLERVDTNSAR
                    **.**:.*** :*****:**: *: .*:.* *:********.***.*:*****:*:*:.*

2338|gene|nrc1      GGMCLVLAEGIALKAPKIQRYTRNLDEVAWPWLQDLIDGT--IGADD------------A
1619|gene|hut       GGMCLVLAEGIALKAPKIQRYTRQLDDVEWPWLQDLIDGT--IGADE-------------
12691|gene|hma      GGMCLVLAEGIALKAPKIQRYTRNLDEVDWPWLQDLIDGT--IGKDE------------A
3092|gene|hhi       GGMCLVLAEGIALKAPKIQRYTRNLDEVDWPWLQDLIDGT--IGKDE------------A
3461|gene|hwa       GGMCLVLAEGIALKAPKIQRYTRQLAEVEWPWLQDLIDDT--IGSDE--HSNNSVKNGEA
476|gene|nph        GGMCLVLGEGIAQKAPKIQRYTSQLDEVDWPWLQDLIDGTYKTGEDT--------DEADA
150|gene|hla        GGMCLVAAEGIALKAPKIQRYTRDLDEVDWPWLQDLIDGT--IGKDGGGASDEAPENAGA
1600|gene|hbo       GGMCLVMAEGIALKAPKIQRYTRQLDEVDWPWLQDLIDGT--IGKDD---------GDKA
                    ****** .**** ********* :* :* *********.*   * *              

2338|gene|nrc1      DEDTPDAGSDSDATDEG-DAPSASTDAEE---PPRAAPSDKFLRDLIAGRPVFGHPSKNG
1619|gene|hut       SEDETGGEEDEDGSADG-ERDTQDDDASTVDGPPRAEPSKKYLRDLIAGRPVFSHPSESG
12691|gene|hma      DEGDSAEDANGDDAGEG-ADDDGGDEADEQAGPPRVEPADKYLRDLIAGRPVFSHPSKSG
3092|gene|hhi       DQADGSDDADSDDGSEG-ANEDSEDESDEQAGPPRVEPADKYLRDLIAGRPVFSHPSKAG
3461|gene|hwa       DIVKTDKDTNESETEDGIDNDDYNDSGLEPANSPRADATNKYLRDLIAGRPVFGHPSAAG
476|gene|nph        DSDDGTDEDAADDSDID-DSSAGDEEADAPSGPPRPDPQKKFLRDLIAGRPVFGHPSEPG
150|gene|hla        EGDDDSEDTAGNESDGD-DADDADSETDGPAGPLRPKSSQKFLRDLIAGRPVFTHPSEAG
1600|gene|hbo       DADDDGDDEEADAEDDE-ADDGETPDSPEPAGPARVDPATKYLRDLIAGRPVFGHPSEAG
                    .          .             .      . *  .  *:*********** ***  *

2338|gene|nrc1      GFRLRYGRARNHGNATAGVHPATMHLLDDFLATGTQIKTERPGKAAGIVPVDSIEGPTVK
1619|gene|hut       GFRLRYGRARNHGNATAGVHPATMHLVDDFLATGTQIKTERPGKAAGVVPVDTIEGPTVR
12691|gene|hma      GFRLRYGRSRNHGFATAGVHPATMHLVDDFLATGTQIKTERPGKAAGVVPVDTIEGPTVR
3092|gene|hhi       GFRLRYGRSRNHGFATAGVHPATMHLVDDFLATGTQIKTERPGKAAGVVPVDTIEGPTVR
3461|gene|hwa       AFRLRYGRARNHGFATAGVHPATMHIVDDFIATGTQLKTERPGKAGGVVPVDSIKGPTVR
476|gene|nph        GFRLRYGRARNHGFATAGVHPAAMHLIDDFLATGTQIKTERPGKAAGVVPVDTIEGPTVK
150|gene|hla        GFRLRYGRARNHGFATGGVHPATMHLVDDFLAAGTQIKTERPGKAHGVIPVDSIEGPTVR
1600|gene|hbo       GFRLRYGRSRNHGFATAGVHPATMHLVDDFLATGTQIKTERPGKAGGVIPVDSIEGPTVR
                    .*******:**** **.*****:**::***:*:***:******** *::***:*:****.

2338|gene|nrc1      LANGDVRHINDPADALDVRNGVAEILDVGEYLVNYGEFVENNHELAPASYAPEWWIQDLD
1619|gene|hut       LANGDVRRIDDPEEAKEVRNGVESVLDLGEYLVNYGEFIENNHPLAPASYTVEWWVQEFE
12691|gene|hma      LANGDVRRIDDAEEALAVRNGVEKILDLGEYLVNYGEFVENNHPLAPASYTVEWWEQDLA
3092|gene|hhi       LANGDVRRIDDAEEALEVRNGVEKILDLGEYLVNYGEFVENNHPLAPASYTVEWWEQDLN
3461|gene|hwa       LANGDVRCINDPEEAEKLQNGVEKILDLGEYLVNFGEFIENNHPLAPAAYVFEWWIQEFE
476|gene|nph        LANGDVRRVDDPEEALEIRNGVEAILDLGEYLVNYGEFVENNHPLSPAAYAPEWWTQDLA
150|gene|hla        LANGEVRRIDDPEEAKEIRNGVEKVLDLGEYLVNYGEFVENNHPLAPASYVYEWWVQEFE
1600|gene|hbo       LANGDVRRIDDPEEALEVRNGVEEIIDLGEYLVNFGEFVENNHPLAPASYVYEWWVQEFE
                    ****:** ::*. :*  :.***  ::*:******:***:**** *:**:*. *** *:: 

2338|gene|nrc1      AAGADVQALRDSPYVDLTAPTADQAMAWATDYDAPLHPAYTYLWHDIDVEQFRALADAVA
1619|gene|hut       AAGADVQAMTDSVEIDLDDPTPSRALQWAREYDAPLHPKYTYVYHDVSVEAIDALADAIA
12691|gene|hma      AAGADVQAMQDSPHIDLADPSAEEAIEWATEYDAPLHPKYTYLWHDVSIEQVCALADAVE
3092|gene|hhi       AAGADVQAMQDSPHVDLADPSAEEAIEWATDYDVPLHPKYTYLWHDVSVDQVCALADAVE
3461|gene|hwa       ASNADVQALRDDPTVDLESPTFENAMRWAKKHDIPLHPAYTYLWHDISVTEFDHLADAVA
476|gene|nph        AAGADVQALADSPRVDLEHPSAEQALEWAERYDAPLHPEYTYLWHDLDVERFEALAAAAS
150|gene|hla        TAGADVQAMRDDPHVDLEHPDVDEALAWAREYDCPLHPEYTYLWHDVSVDAFEALADAVA
1600|gene|hbo       AAGAPIQALEDDPSVDLEHPTPERAFEWATEYDCHLHPDYTYLWHDVSVAEFEALADAVS
                    ::.* :**: *.  :**  *  . *: **  :*  *** ***::**:.:  .  ** *  

2338|gene|nrc1      DAHTD--ASD-----------------DDDRGVLVLDHTTTVRETLEALLVTHHQGDDTI
1619|gene|hut       DGEIV--TGDGATAEPGD--HADRA--GTATGDLVLPRSEIARRTLESLLVEHTQTDASL
12691|gene|hma      DAQVA--QADGAYADPEM--DGTAGDAHSDDGALVLPRSDAVQQTLEHLLIGHTQDEETI
3092|gene|hhi       DAKVA--QADGAYADPEAEADDTAGETYSDDGALVLPRTDAVQRTLEHLLVEHTQDDDRI
3461|gene|hwa       AGEITMNEVSDTNSASGN--TSLRAN-TNTDDTLTIDTTPAIRETMERLLIEHHQDSDSI
476|gene|nph        EGHWA--ETDGAQQTRPP--D------GAAESTLVVPRSEPVREALEVLLVEHTQGEETL
150|gene|hla        AGDVV-------------------------EGVLAIERTETTQHALESLLVQHVATPDAL
1600|gene|hbo       SGRIADVEADGGVVVRPT--DT-----DPTDGILELDRTEDVTRTLEQLLVEHTQTEETL
                     .                             . * :  :     ::* **: *      :

2338|gene|nrc1      RVDDWLPLARSLGVTESLD-------REW--ETLSEAAAEW-------------------
1619|gene|hut       IVPTWRPLVETLGFNDDLT-------RPWTLSDLSEAARTY-----------------DD
12691|gene|hma      TVTDWVPLVRTLGFSRSLE-------RDWTREDLSEHARTYGESESLDAIGVAEDAERED
3092|gene|hhi       TVTDWVPLVRTLGFSRSLE-------RDWTPADLSERARTYGESESLDAIGVAEDAERED
3461|gene|hwa       HIPAWRALALSLGIKIESDNDTGIGDRMWSLTDLSKHARKQ-----------------DD
476|gene|nph        TVPDAEPLVRSLGLTEGLE-------RTW--DELSTAARSY-----------------DD
150|gene|hla        RIPTWRPLARSLGIDDGLR-------KTWSADDLSAAAREW-----------------DD
1600|gene|hbo       RIPEWRPLVRSLGLTEELE-------QTW--DDLSAEAREW-----------------DG
                     :    .*. :**.            . *    **  *                      

2338|gene|nrc1      -PNAVRAVNEVAPFSVQERAPTRIGNRMGRPEKSESRDLSPAVHTLFPIGDAGGSQRDVA
1619|gene|hut       GENAIEAVNEIAPFDVRERAPTRIGNRMGRPEKSEERELSPAVHTLFPIGEAGGNQRDVA
12691|gene|hma      GQNAIKAINEVAPFQVRERAPTRIGNRMGRPEKSERRDLSPAVHTLSPIGEAGGAQRDVA
3092|gene|hhi       GQNAIEVINEIAPFQVRERAPTRIGNRMGRPEKSERRDLSPAVHTLSPIGEAGGAQRDVA
3461|gene|hwa       GKSAIAAVNEVAPFQVRERAPTRIGSRMGRPEKSEDRDLSPAVHTLFPIGEAGGNQRNLS
476|gene|nph        GDNAVRAVNEVAPFEVRERAPTRIGCRMGRPEKSEKRDLSPAVHTLFPIGEAGGSQRDIA
150|gene|hla        GENAVKAINEVAPFEIRERAPTRIGNRMGRPEKSESRDLSPAVHTLFPINEAGGPQRDVA
1600|gene|hbo       GDNAVKAVNEVAPFDVRERAPTRIGNRMGRPEKSESRDLSPAVHTLFPIGEMGGSQRDVG
                      .*: .:**:***.:.******** ********* *:******** **.: ** **::.

2338|gene|nrc1      DAARYAPDMSDTPGEIPVRVGDRVCPSCDEHTYESRCPDCGDWTDPHYECRDCGAVATPD
1619|gene|hut       KAAGHADEMGDAPGEVELEVGRRRCTDCATETYQARCPDCNGITETIYVCPDCDREVDPD
12691|gene|hma      KATKHADDMSDTPGQVEVEVARRRCPDCGTETHQANCAECSGTTEPVYVCPDCEAEVERD
3092|gene|hhi       KATKHADGMSDTPGHVEVEIARRRCPDCGTETHQAGCPDCGGTTEPVYVCPDCEAEVERD
3461|gene|hwa       DAAQSFGD-NTERGQISVQLGKRRCPYCETVGFELQCAECGRHTEPQFVCRECESVLSPD
476|gene|nph        EAATHAESMQDTPGEVEVQVGRRQCPACDTETFRARCPDCESVTDPRYVCYDCNIDVDPD
150|gene|hla        EAAGTMDD-SGHRGRLDLEVSDRVCPDCGEHTYRAQCPDCGVHTDLHYECGDCGTVCEPD
1600|gene|hbo       EAARERNE-RGARGEVNVLVGDRQCPDCGTQTYKNVCPECETHTEPHYECEECGTVVEPD
                    .*:          * : : :. * *. *    .   *.:*   *:  : * :*      *

2338|gene|nrc1      ESGRVECPNCGRDLDNVTTQVIDINDEYHGALRAVGERENAFDQLKGVKGLLSAEKTPEP
1619|gene|hut       ESGRAECPRCETIASPTRMTTIDVGEVYQQAMDSVGEREVAFDVLKGVKGLTSKEKMPEP
12691|gene|hma      ESGRAECGRCETLASPTQYKVLDLQEAYRDALQNVGERETAFEQLKAVKGLTSEEKVPEP
3092|gene|hhi       ESGRAECTRCETLASPTQYKVLDLQEAYRDALQNVGERETAFEQLKAVKGLTSEEKVPEP
3461|gene|hwa       ESGRVHCDRCERDVTSAEWQDIDLHQRYRDALDRVDERESSFEILKGVKGLTSSNKTPEP
476|gene|nph        ESGRAICPNCEREADAVQNRTVNVHEEYRSALSNVGERENAFDVLKGVKGLSSEHKVPEP
150|gene|hla        EAGRVECPRCEWEVTAATYQEVDLNDAYRSALETVGERESAFEILKGVQGLTSRNKTPEP
1600|gene|hbo       ESGRVFCERCEREVESPDWYAIDIGAELRAALENLGERESSYPILKGVKGLTSSNKTPEP
                    *:**. * .*           :::    . *:  :.*** ::  **.*:** *  * ***

2338|gene|nrc1      MAKGVLRAKHDVTAFKDGTVRYDMTDLPVTAVTPAELDVTAGQFRELGYNQDIHGDPLEH
1619|gene|hut       MEKGVLRAKHDISAFKDGTVRYDMTDLPVTSVRPAELDVTVEQFRELGYEADIQGDPLIH
12691|gene|hma      MEKGILRAKHDVSAFKDGTVRYDMTDLPVTAVRASELDVSAERLRGLGYTEDIHGDPLTH
3092|gene|hhi       MEKGILRAKHDVSAFKDGTVRYDMTDLPVTAVRASELDVSAERLRGLGYTEDIHGDPLTH
3461|gene|hwa       LEKGILRAKHGVSSFKDGTVRYDMTDLPVTAVRPKELDVTAAHFRELGYQTDINGNPLQF
476|gene|nph        IEKGVLRAKHGVSAFKDGTVRYDMTDLPVTSVRAAELDVTADQLRSLGYETDIHGEPLTH
150|gene|hla        IEKGVLRAKNGVTSFKDGTVRYDMTDLPVTSVRAEELDITADHLREIGYETDIDGEPLRH
1600|gene|hbo       IEKGVLRAKHGVSSFKDGTVRYDMTDLPVTSVRPAELDVTADHFRELGYETDINGEPLQF
                    : **:****:.:::****************:* . ***::. .:* :**  ** *:** .

2338|gene|nrc1      DDQLVELRVQDVVLSDGAADHMLKTADFVDDLLTQYYGLDAFYDLDDRDDLVGELVFGMA
1619|gene|hut       DDQLVELNVQDVVLSDGAAEHMLKTAAFIDDLLESYYGLDPYYELEDRDDLVGELVFGMA
12691|gene|hma      EDQLVELKVQDIVLSDGAAEHMLQTARFVDDLLEQYYGLERFYEFDDREDLVGELVFGMA
3092|gene|hhi       DDQLVELKVQDIVLSDGAAEHMLQTARFVDDLLEQYYGLERFYEFDDREDLVGELVFGMA
3461|gene|hwa       DDQLVELKVQDIVLPDGAAEHMMKTADFVDDLLEQFYELNQFYQIDERDDLIGELVFGMA
476|gene|nph        EDQLVELRVQDVVLSNGAAEHMLRTADFVDDLLEQYYGLEPFYDAEDRDDIVGELVFGMA
150|gene|hla        DDQLVELRVQDIVLSDGAAEHMLKTAGFVDDLLEQFYGLDRFYEFNERDDLVGELVFGMA
1600|gene|hbo       DDQLVELKVQDIVLSDGAAEHMLKTADFVDDLLTEFYGLEPFYEVSERDDLVGELVFGMA
                    :******.***:**.:***:**:.** *:**** .:* *: :*: .:*:*::********

2338|gene|nrc1      PHTSAAVVGRVAGFTSASVGYAHPYFHAAKRRNCFHPETNVWFRDESGEWHHDPIETLVE
1619|gene|hut       PHTSAATVGRVVGFTSAAVGYAHPYFHAAKRRN---------------------------
12691|gene|hma      PHTSAATVGRVVGFTSAAVGYAHPYFHAAKRRNCFHPDTRLWYEDENDDWEYGTIEELVE
3092|gene|hhi       PHTSAATVGRVVGFTSAAVGYAHPYFHAAKRRNCFHPDTRLWYEDENDDWEYGTIEELVE
3461|gene|hwa       PHTSAAVVGRIVGFTSAAVGYAHPYFHAAKRRNCFHPETKIWFRDTDNEWHHETIQTFVE
476|gene|nph        PHTSAAVVGRVIGFTSAAVGYAHPYFHAAKRRN---------------------------
150|gene|hla        PHTSAATVGRVVGFTSAAVGYAHPYFHAAKRRNCFHPETEIEYRDDAG-WHRETIEKFVE
1600|gene|hbo       PHTSAAVVGRVVGFTSAAVGYAHPYFHAAKRRN---------------------------
                    ******.***: *****:***************                           

2338|gene|nrc1      ARLDPDTADEDDFGALVQALDGD----VFVPSVTEDGEETLQRVEAVSKHPAPDHLLAVE
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      SRL--DDPQEDDFGTLVQELDGD----LTVSSLGENGPCR-QPVDAVSKHPAPDHLVEV-
3092|gene|hhi       NRL--DDPDEDDFGTLVQELDGD----LTVSSLGENGPCR-QPVDAVSKHPAPDHLVEI-
3461|gene|hwa       DRL--DDPEIDAVGTLVQEVDDNTDREISVPSIDDNGNERLQSVTAVSKHRAPNHLVQIE
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ERL--NDPQTDDFGTLVNELDGN----VEVPSIDEHGNKSTQPVTAVSKHLSQDHLVQVE
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      TKRGRELTVTPDHSMRRWTGDGIERVDARELTAGDALPAPTQVPGDGET-----------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      AVGDRTLRVTPDHTMLRAGPDGIEEVPASDLAAGDDLPAYDGGETTTMT-----------
3092|gene|hhi       SVGDRTLRVTPDHTMLRAGSDGIEEVPAGDLTAGDELPAYDGGETTTMT-----------
3461|gene|hwa       TISGREITITPDHEMHIFEQGNLVSKQASKITSGEYAVIPKRLQTISPSSHTPQHDLLRE
476|gene|nph        ------------------------------------------------------------
150|gene|hla        TQRGRSIRVTPDHTMLRVADGGVQKVAANELEIGDSVPTTTLRHEM--------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       FLTRDELTADRLIIHTSDPVRLCNRVFPEEVTSCKDAVEIMQNTACHLDKNKETLIGWLG
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       EGRIPVALLRGFVETDEALLMSIPDDVQIGLRGEKVRIDRHIGFTEELTSLLGYYAAAGI
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       VHTQTNPISYESAQQEQSRITFYNIDTQTQTDLLNALNSVFEIEPIQYNLDGEILGVPGE
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       LIRRVFDTVFDVGTQPSHKRIPQALFDASESHITSYLRCFFSTHDSLTTDTRDISATTVS
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       REFKEDIIAALRRLGITAEVTTQQSRSVPEVLPDWYAIDDITHHDADNSLNLTRSYVISI
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ---------------------ATSELRSESLDGTHPQRRFGDGGSVRTDEVVSVEPVRSS
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ---------------------ARGEASTAATDGAAP-----------TDTVEAVEYVESD
3092|gene|hhi       ---------------------ARGEASTAATDGAAP-----------TDTVETVEYVESN
3461|gene|hwa       ASSDAVTLQRDRQAQEQIKYDAQGLIANNNAIHQSRQVTDGGRKDYITEPITDIEYVDAD
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ---------------------SVGATVDVTTDGGIE-----------ADTVASVDFLESD
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      VDHTYSLTVAETNTLVANGLFTGQCDGDEDCVMLLMDGLINFSKSYLPDKRGG-------
1619|gene|hut       ------------------------CDGDEDCVMLLLDGLLNFSVKYLPNQRGG-------
12691|gene|hma      VDHVYCLTVADTHRVAVEGTYVGQCDGDEDCVMLLMDGLLNFSKSYLPNQRGG-------
3092|gene|hhi       VDHVYCLTVADTHRVAVEGTYVGQCDGDEDCVMLLMDGLLNFSKSYLPNQRGG-------
3461|gene|hwa       IDYTYCLTVSETHSLIVNDLSQKQCDGDEDCVMLLMDGLLNFSREYLPDKRGGSVAADSR
476|gene|nph        ------------------------CDGDEDCVMLLLDGLLNFSKTFLPDQRGG-------
150|gene|hla        IEHTYNLTVAETHTLAANDLLVAQCDGDEDCVMLLMDGLLNFSKTFLPDQRGG-------
1600|gene|hbo       ------------------------CDGDEDCVMLLMDGLLNFSKEFLPDKRGG-------
                                            ***********:***:***  :**::***       

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       LVAVSPDDKIVFTTIEDFWKKLNTPIERNGKFRKRTCVSEGWQTYAFDENHEASLRPIEK
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       AIRYTADESEQLRRITTQLGRSLDITDEHSLFRYDDGIEEVAGDDLTAGDIIVAPRTLDV
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       EVTQTTLDLSEYIHDNERCPSEQTGSGELNLASKSAISDSRNKETPGVTHNILPQRSKFT
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       DEMTTLSPTAVGGLESEQNETLRVGESTGAIERYINVDDSFGWLLGQFIAQRSISTDALT
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       MTVHTAAEKHAERIVATSDSVFGIKPTVNSIERGYEIVFPSVFDTIVSGLTAKEQSEPEQ
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       DVDHTHTDEIGIPECILHAPDDIVLSFLQGFILAENAQRKGNAASEASEMVSESETTVTL
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       ETPSVGVKDGLVFLCHRLGVITDISEKSGEEYSVHFEESRYTVSIATEGKTNPLDQILNG
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ------------------------------------------------------------
1619|gene|hut       ------------------------------------------------------------
12691|gene|hma      ------------------------------------------------------------
3092|gene|hhi       ------------------------------------------------------------
3461|gene|hwa       ERPTMPEGVSVPVPDALLTIHESIANSPHIDQVIPDTVVQQETVSLETLQSLLTGLSTVD
476|gene|nph        ------------------------------------------------------------
150|gene|hla        ------------------------------------------------------------
1600|gene|hbo       ------------------------------------------------------------
                                                                                

2338|gene|nrc1      ---------------------------------------------------------RMD
1619|gene|hut       ---------------------------------------------------------RMD
12691|gene|hma      ---------------------------------------------------------QMD
3092|gene|hhi       ---------------------------------------------------------QMD
3461|gene|hwa       LPAQLEAKRDELTLLTEGDLSYLRVESVECVDYDGYLYDLQVGGEPVFTANWLYAHNSMD
476|gene|nph        ---------------------------------------------------------RMD
150|gene|hla        ---------------------------------------------------------RMD
1600|gene|hbo       ---------------------------------------------------------QMD
                                                                              **

2338|gene|nrc1      APLVMSSRIDPAEIDDEAHNIDIDREYPREFYEATRELADPEDVADLITLAESTVGTDEE
1619|gene|hut       APLVMSSRIDPAEIDDEAHNIDIVEQYPLELYEATREMAHPEDVD--VKIAEDTLGTDEE
12691|gene|hma      APLVMSSRIDPSEIDDEAHNMDIMDAYPREFYEATREMKDPTEVEDVMKIAEETLGTDRE
3092|gene|hhi       APLVMSSRIDPSEIDDEAHNMDIMESYPREFYEATREMKDPTEVEDVMKIAEETLGTDRE
3461|gene|hwa       APLVMSSRIDPSEIDDEAHNMDIVRQYPREFYEATRRMEDPDEWEEEVTIAEEYLDTDNE
476|gene|nph        APLVMSSRIDPAEIDDEAHNMDIVSSYPRAFFEATREMADPGEVESLIQLGEDTLGTADE
150|gene|hla        APLVMSSRIDPSEIDDEAHNVDIAREYPREFYDATLEMADPESVEDLIQIGEDTLGTDEE
1600|gene|hbo       APLVMSSRIDPSEIDDEAHNMDIVRQYPTEFYEATLEMADPGEVEDLIQLGEDTLGTDDE
                    ***********:********:**   **  :::**  :  * .    : :.*. :.*  *

2338|gene|nrc1      YTGFGHTHATSNIHLGPSLSAYKTLGSMMDKMDAQLELARKLRSVAETDVAERVIEYHFL
1619|gene|hut       YTGFAHTHDTSNIALGPDLSAYKTLGSMEDKMDAQLEISRKLRAVDETDVAERIIEYHFL
12691|gene|hma      YTEFRHTHDTANIAAGPDLSAYKTLGSMEDKMDAQLEISRKLRAVVESDVAERIIEYHFL
3092|gene|hhi       YTEFRHTHDTANIAAGPDLSAYKTLGSMEDKMDAQLEISRKLRAVVESDVAERIIEYHFL
3461|gene|hwa       YTGFNHTHDTTDIAAGPDLSAYKTLDSMMDKMDAQLELARKLRAVDETDVAERVIEYHFL
476|gene|nph        YRGFEHTHDTVDLAAGPDLSAYKTLGDMMEKMDAQLELSRKLRSVDETDVAERVIEYHFL
150|gene|hla        YHGFGHTHDTTDIAMGPDLSAYKTLGDMMEKMDAQLELARKLRAVDETDVAERVIEYHFL
1600|gene|hbo       YRGFDHTHDTSDIALGPDLSAYKTLGSMMDKMDAQLELARKLRAVDETDVAERVIEYHFL
                    *  * *** * ::  **.*******..* :*******::****:* *:*****:******

2338|gene|nrc1      PDLIGNLRAFSRQETRCLDCGEKYRRMPLSGDCRECGGRVNLTVHEGSVNKYMDTAMRVA
1619|gene|hut       PDLIGNLRAFSRQDVRCLGCGEKYRRMPLTGTCRECGGDVNLTVHEGSVNKYIDTATRVA
12691|gene|hma      PDLIGNLRAFSRQEVRCLDCGESFRRAPLTGDCRECGGRVNLTVHEGSVNKYIDTAIRVA
3092|gene|hhi       PDLIGNLRAFSRQETRCLDCGESFRRAPLTGDCRECGGRVNLTVHEGSVNKYIDTAIRVA
3461|gene|hwa       PDLIGNLRAFSRQQTRCLDCGESYRRMPLTGECRECGGRVNLTVHEGSVNKYMDTAIHIA
476|gene|nph        PDIIGNLRAFSRQETRCLDCGEKYRRVPLTGDCRECGGRVNLTVHQGSVNKYIDTAIQVA
150|gene|hla        PDIIGNLRAFSRQKTRCLDCGEKYRRMPLSGDCRECGGRVNLTVHEGSVSKYVDTAIEVA
1600|gene|hbo       PDLIGNLRAFSRQETRCLDCGEKYRRMPLTGDCRECGGRVNLTVHQGSVNKYMDTAIQVA
                    **:**********..***.***.:** **:* ****** ******:***.**:***  :*

2338|gene|nrc1      TEYDCREYTKQRLEIMDRRLESVFEDDTNKQSGISDFM
1619|gene|hut       EEFGAREYTKQRLEILDRAIKRVFEDDTSRQTGIGDFM
12691|gene|hma      DEFGARDYTKQRLKILERKIESVFENDHNKQSGIADFM
3092|gene|hhi       DEFGARDYTKQRLKILERKIESVFENDHNKQSGIADFM
3461|gene|hwa       EEFDCREYTKQRLEVLERSLESIFEDDTNKQSGIADFM
476|gene|nph        EEYGCREYTKQRLRILDRAVESIFEDDTNKQSGIADFM
150|gene|hla        DRFGCRPYTKQRLKVLDQSLESIFEDDTNKQSGIADFM
1600|gene|hbo       EEFDCRPYTKQRLEVLEKSLESVFENDKNKASKLGDFM
                      :..* ****** :::. :: :**:* .. : :.***