HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0270COG1711arCOG00551Uncharacterized protein conserved in archaeaarchaeal GINS homolog.involved in DNA replication

HOG Organism Gene ID Name Annotation
cHOG0270 nrc1 VNG1471 agh archaeal GINS homolog.involved in DNA replication
cHOG0270 hmu HMUK2483 Hmuk_2483 conserved hypothetical protein
cHOG0270 hma RRNAC0293 hypothetical protein
cHOG0270 hwa HQ2718A primase operon protein
cHOG0270 hla HLAC1797 Hlac_1797 hypothetical protein
cHOG0270 hbo HBOR11520 Hbor_11520 uncharacterized conserved protein
cHOG0270 hut HUTA2752 Huta_2752 conserved hypothetical protein
cHOG0270 hvo HVO_2698 HVO_2698 conserved hypothetical protein
cHOG0270 nph NP3992A primase operon protein
cHOG0270 hhi 1035 HAH_1035 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2718|gene|hwa      MDLTELQDVQRTERQMDSLQHLSDTFYADVAEYIAERKAERRRLASTTDDPFGDPAVGRL
1797|hp|hla        MKLDELRSAQAKERRKDSLQHLRDSFYDDVAAYVADLRAARDRRAEQVAKPFSDDDVRRM
11520|hp|hbo       MNLDELRSVRRTERQKDSLQHLRDSFYEDVADYIAQQKAERKRAADRADDPFSDPEVGRL
3992|gene|nph      MNLDELQSVQARERQSSDLQQLRPSFYREVGAFVQELTEQRARVVEEVDDPFSSPKVRQL
1471|chp|nrc1      MNLDDLRAAQTQERATDGLQDLQESFYADVAAFIESLKDRRDDAAAAATDPFGDPEVQEL
2752|chp|hut       MDLDEIQSVQSRERQTDSLQQLRDSFYEEAGQFVRSLRAERERAAEAAEDPFDSPKVARL
10293|hp|hma       MNVDELQSVQSRERQTDQLQQLRETFYEDAGQFIQQLRSERDRAAERAEDPFDSPEVNRL
1035|hp|hhi        MNVDELQSVQSRERQTDQLQQLRETFYEDAGQFIQQLRSERDRAAERAEDPFDSPEVNRL
                   *.: ::. ..  **  . ** *  :** :.. :: .    *   .  . .**..  *  :

2718|gene|hwa      TDEIKTAEEVVKAIYERRIGKVVKLASFDAADMKTDTAGLTSEERELFDDLVNRIITNRE
1797|hp|hla        SDEVETAEEVAEALYERRVGKVVKLASFAAADMPVDADGMTTEERQLFDDLVDRISENKS
11520|hp|hbo       TDEIETAEDVVEAIYERRVGKVVKLASFAAADMSADTNGLTAEERDLFDDLVSRIKQNRE
3992|gene|nph      TNDIETAEQTVEAIYERRVGKVVKKASIAAAGMPVDDAGLTDEEERLFEDLVDRIEDNRD
1471|chp|nrc1      TDKIETAEQVTEAIYERRMGKLVKQASLAAAGMPDDQGGLTAEERDLYGDLVARIEDNKA
2752|chp|hut       SDDIDTAEQTLQAIYERRVGKVVKMASLAAADMPTEEEGLTTEERDLFEDLVDSIESNRQ
10293|hp|hma       TDDIKTAEQTVEAVYERRVGKIVKMASLAAADMPTEDDGLTQEERDLFETMVEAIESNRG
1035|hp|hhi        TDDIKTAEQTVEAVYERRVGKIVKMASLAAADMPTEDDGLTREERDLFETMVEAIESNRG
                   ::.:.***:. :*:****:**:** **: **.*  :  *:* **  *:  :*  *  *. 

2718|gene|hwa      HVLSVLGGEGTEDSDSTSVETPASADENATQNETDESVPAEPADNKHKATVESQSQETNS
1797|hp|hla        RVLDVLAGEAP----PAS--TDAVPTDDATPLGDATNAPPSTDESA-TADSAPPAPD---
11520|hp|hbo       TVLDVLAGKRS----GSA--T-TTEMGNTSSGGTDVPAAESTSQTT-PDEVPPADPGTDE
3992|gene|nph      AVLSVLDGDGP----DVS----CSVGGTEQPKSKTEPAAADTSEPD-APTAPDGRS----
1471|chp|nrc1      HVLDVIAGDAA----------------SARPDGDDPAD----------------------
2752|chp|hut       RVFDVLDGESM----AVA-------GQTESPVDDDPSAASEG-------TTGER------
10293|hp|hma       HVLNVIAGEAP----TGAVGDEPNSGERQAPDPDPQQTADEA-------TAGEPE-----
1035|hp|hhi        HVLDVIAGEAP----TGAVGDEPKSDERQAPDPEPRQTANEPAADT-ADTADPPEP----
                    *:.*: *.                                                   

2718|gene|hwa      HPGIPNTGAESNADADSNGDSDASPEVDIDIENQTNADSIPDSHVATEVSTDTETETETE
1797|hp|hla        -PEPPAET----------------------------------------------------
11520|hp|hbo       TPPPPPE-----------------------------------------------------
3992|gene|nph      -SPSAEDG----------------------------------------------------
1471|chp|nrc1      -PGSPAPD----------------------------------------------------
2752|chp|hut       -PPSTASS----------------------------------------------------
10293|hp|hma       -QSTPDTG----------------------------------------------------
1035|hp|hhi        -PSTPDTG----------------------------------------------------
                       .                                                       

2718|gene|hwa      RQRSHSSGDSLPPDPDDVLAAAMGDGGDIVDATDESSVDTNTDTSDTDQSNPAINGDTTA
1797|hp|hla        ------------PSGEDDEAPGTGESADALAGAMGSSDDEVADALDATTDVTTDGESRAT
11520|hp|hbo       ------------VDPEADSQTPADGAGDVLADAMGDGPSAGDET-------PVRDDTPPT
3992|gene|nph      ------------VSAADLMGSGSDEGGDSDEPAADTPVEPSAPDQSTPSEAEQPTASDPE
1471|chp|nrc1      ------------SDAGDTS------PRDASPPAGGSSVA---------------AAMGGD
2752|chp|hut       ------------TDASDSTGA----PPEPAESRSAATDDEVPAA-------DLMRGSSTA
10293|hp|hma       ------------VDAADMMGS----GGDQSPPAADSDA-PTPPP-------ELDTGSNPT
1035|hp|hhi        ------------VDAADMMGS----GGDQSEPA-EEPDTPTPPP-------DLDTGSNPT
                                .             :                                

2718|gene|hwa      QSTSRNPNRSNTNTDTPNNLQAQSQAPASVSELSSQSTQVDSDPHSNVNANPEVDPQPHP
1797|hp|hla        DGSPADGNATADDAS-------------------------------AGDGPTPVPPEPAP
11520|hp|hbo       DTSSATP--------------------------------------------ESMADGATA
3992|gene|nph      QPAPPEPEQPSTATA-------------------------------EQPIPSEGPPAPNP
1471|chp|nrc1      DGGTLDP-----------------------------------------------PPAPEP
2752|chp|hut       DGGQTDP---------------------------------------------DTGASSAP
10293|hp|hma       ADGQTDP----------------------------------------ADVP-AGDDVPAP
1035|hp|hhi        ADSQPDQ----------------------------------------ADVPAAGDDVPVP
                                                                            . .

2718|gene|hwa      ADSSTTPSAEPTDIN--RDSDNILNAQTETETETKTKTDEDSGSLERETEPEVESDLPPD
1797|hp|hla        PGTPGTDASDDP-----------------AESDDEATADTAD------------------
11520|hp|hbo       TDTAATDSTDGDRPT--TEAE--------AVAAEQPSNDSTD----------------SA
3992|gene|nph      EQPSGDGHPVPPDPP--EQAEATDGGTAAAGPSTESASDATE----------------TA
1471|chp|nrc1      PGDGGAD-----RVD--TTTD--------GGVQSEPADDAGV----------------PD
2752|chp|hut       ADDTKVPAAGGDGPDPTTRRD--------GGPPGSVAEDGDG----------------SA
10293|hp|hma       PAEQSAESTSGPAADP-TQAD--------GGTQSPASADTG-------------------
1035|hp|hhi        PAEPGVESDPGPAADP-AHAD--------SGPQSPAGSDTAG------------------
                                                         *                     

2718|gene|hwa      TLSDDPDRVVLRITADVGRILGVDQREYDLAAEDIIMLPETNAEPLLSRDAAERLD
1797|hp|hla        -AADSSDRATVRITRDVGAIFGVDEREYDLANEDVVTLPAENADPLVQRDAAERLD
11520|hp|hbo       TEADDTERVTLRITQDVGQILGVDEREYDLATEDVVTLPTTNADPLLERGAAERLD
3992|gene|nph      SSMPGLPRTTVRITADVGEIVGADDRDYELGSEDVVTLPEPNAEVLVEKDAAERLD
1471|chp|nrc1      SGDAATARVRVRVTDTVGEILGVDERPYDLEAGDVVTLPEANADPLIEKDAAEKLD
2752|chp|hut       STTADVERTTVRITSDVGEILGVDERTYDLVAEDVVTLPATNAEPLVERGAAETLR
10293|hp|hma       --AADVDRRTVRITDDVGEIFGVDQREYDLSTDDVVTLPADNADPLVEQDAAEPLE
1035|hp|hhi        --TADVDRRTVRITDDVGEIFGVDQREYDLSTDDVVTLPADNADPLVEQDAAEPLE
                          *  :*:*  ** *.*.*:* *:*   *:: **  **: *:...*** *