HOG Organism Gene ID Name Annotation
aHOG2699 hla HLAC1354 Hlac_1354 histidinol phosphate phosphatase HisJ family
aHOG2699 hmu HMUK1743 Hmuk_1743 PHP domain protein( EC:3.1.3.15 )
aHOG2699 hut HUTA0332 Huta_0332 PHP domain protein
MUSCLE (3.6) multiple sequence alignment


1354|gene|hla      MTRRAIPADPKLRVDPERTRSVYDYHVHTNYSDGAFLSRMVDAATDAGLDGVGITDHCNV
332|gene|hut       ---------------------MYDYHVHTTYSDGSFLPRMIDAAERAGLDGVGFADHCNV
                                        :*******.****:**.**:***  *******::*****

1354|gene|hla      SPDPAAERFKRTFGFNLDLTYERRREAIERLRADPDVGIDVFDAVEMDYDPDHEAAIADF
332|gene|hut       FDAEADQAYREASGFNLDLTYERRRRAIDRARERTD--LRLFDAVEMDYHAAREEAIESF
                       * : :. : ************ **:* *  .*  : :******** . .* ** .*

1354|gene|hla      LAEAGFDYAIGSVHELDGANVHTRSHFADKPASERRALVDRYFEKLVALIDSELFAIAAH
332|gene|hut       LEDADFEYAIGSVHAIDGVNVHNQSYFAGLSETEREAAVEMYVDHLISLVDSELFEIAAH
                   * :*.*:******* :**.***..*:**. . :** * *: *.::*::*:***** ****

1354|gene|hla      PDLVERNPHLRGFATADHYAAVAEAFRDSRTIPEINAGRLLDDYGEFHPAPAFLSRLVDA
332|gene|hut       VDLVERNEALRGLLTEDHYGRIADAFTDSRTVPEINAGRVLDAYGEFHPSESFAELLVDA
                    ******  ***: * ***. :*:** ****:*******:** ******: :* . ****

1354|gene|hla      GVRVSVGTDSHEPGVIAPRIDEIEAEMDRRGLDPVRLDKLAED
332|gene|hut       GVSFTIGSDAHAPGSLIDCSEELRAVREEWHLPIVELDLV---
                   ** .::*:*:* ** :    :*: *  : . *  * ** :