HOG Organism Gene ID Name Annotation
aHOG2696 hbo HBOR20400 Hbor_20400 sugar kinase, ribokinase-like( EC:2.7.1.4 )
aHOG2696 hla HLAC2162 Hlac_2162 PfkB domain protein
aHOG2696 hut HUTA0501 Huta_0501 PfkB domain protein
MUSCLE (3.6) multiple sequence alignment


2162|gene|hla       ----------MTDILVAGETLVDLLPGAGETLHDVDGFTHRPGGAPANVAVGLTRLGSPP
20400|gene|hbo      MTRNATTDSDAPRVVVAGEMLIDFLPDRQGPLESVASFTKRPGGAPANVAVALSQLDETP
501|gene|hut        --------MTDPDVLIAGETLVDLFPTTTGPLANAETFDRRAGGAPANLAVAMTRLGTAP
                               . :::*** *:*::*    .* ..  * .*.******:**.::.*. .*

2162|gene|hla       AFWTRLGDDPFGDFLRETLDEEGVPDALSQRVA-GNTTLAVVSPPGVDGRRFRFYGSRDV
20400|gene|hbo      AFATRVGDDPFGDFLVETLSEAGLDTELVERDPEAKTSLAFVALGEEADRGFSFYRDRTA
501|gene|hut        YLWTRLGADPFGEHLADVLETQGVSDRFVEVDADRKTAHTLVGDDPAADQSFVFYKEGTA
                     : **:* ****:.* :.*.  *:   : :  .  :*: :.*.     .. * ** .  .

2162|gene|hla       TFGFEPDTVPTDALASASWVHLGGVALTHPVGRTAMRELAAVADERGCTVSFDVNYRPDL
20400|gene|hbo      DTRMQPGSVPDATLASADWVHVGGVTLADEPSRTATFDLMRRGQDAGATVSFDPNARPEL
501|gene|hut        TMAMEPGTVPDETLANLEWVHFGGVMLCEAPVRTAMLDLAERAQAQACTVSFDPNTREDL
                       ::*.:**  :**. .***.*** *     ***  :*   .:  ..***** * * :*

2162|gene|hla       V-PEGERDAVVEAIRDILADTDVAFASDEDVAAT-GISSREGEGLARDVLEFGPHTAVVT
20400|gene|hbo      W-DEFDFEA---SVAEAFELADVVKATPEDLEAL--DYEGDPETMARRIRSDGPHTVFLT
501|gene|hut        WADPADLEP---TMRRALELADVVKTDREDLSVLLETIDQEIASVAEELLAYGPHTVFLT
                         : :.   ::   :  :**. :  **: .     . :   :*  :   ****..:*

2162|gene|hla       LGSAGAVAASMDAAPWG--ETTARHGGFTVDAVDATGAGDAFTSGLINRLAAGADDAGDP
20400|gene|hbo      LGSKGSLVSASEESPWVTEETVVSHEGYDVEPVDTTGAGDAFTAGVVAALVEG-------
501|gene|hut        RGAEGTYGMATADAPWGPAET--DQPAFDVDAVDTTGAGDAFTAGTITALLAG-------
                     *: *:   :   :**   **   : .: *:.**:********:* :  *  *       

2162|gene|hla       PDLADALAFANATAALSVRDHGGMTALPDREAVEAFVAERA
20400|gene|hbo      QSLAETLSFANAVAAVTTTATGAMTALPDRESVRQFRES--
501|gene|hut        RSLSDAVTFGNAVGALTTTETGAMEPLPDREAVERLIAAQ-
                     .*:::::*.**..*::.   *.* .*****:*  :