HOG Organism Gene ID Name Annotation
aHOG2692 hla HLAC2158 Hlac_2158 histidine kinase
aHOG2692 hut HUTA2850 Huta_2850 histidine kinase
MUSCLE (3.6) multiple sequence alignment


2158|gene|hla      MTGRYDTRDTREGRLTELLVTLGVTEPDHVSVEPEGGIARVAAALFVSVSGFALLIPNVT
2850|gene|hut      -----------------------------------MDFIRLGSGASVSATGVLVFAIALS
                                                       .: *:.:.  **.:*. ::   ::

2158|gene|hla      PLVSGGEPPIGIALSVLGTVLSVALVLVG-GLLYRSTFTTRNAVRIAVWSLFGIVVLGGI
2850|gene|hut      VVWNGAVSLYDVALVGIALVVGLTLVAAGAALVVLDALRTDHVLRVAGWNALGVVVL-GI
                    : .*. .  .:**  :. *:.::** .* .*:  .:: * :.:*:* *. :*:*** **

2158|gene|hla      MLGIIRYQAQLGTPMVA-PTFTVAKVLSIGAVAHVIIGVYDARRVRAQQLANEQRRVSVL
2850|gene|hut      VLALVS-----ASPSVSLPPVVVADVLGVSAVAHVLIGVNDVRRIRVGELARERQKLAVL
                   :*.::      .:* *: *...**.**.:.*****:*** *.**:*. :**.*...::**

2158|gene|hla      NRMIRHNLRNETTVLGGHASLIAERVDDPELRDSAEAVAKSAAVIGGLAKDANRLQAAFE
2850|gene|hut      NRIVRHNLRNDAQVLLGNAEALLGELDDDRHRGMADSIAGKATSLASMNEKLGKFQAAIE
                   **::******:: ** *:*. :   :**   *. *:::* .*: :..: :. ..:***:*

2158|gene|hla      RRPDARGAVPVEPLIEDAAEAAREAGAE-TVAVDVEPCAAL-ADDRLATAVEELATNAPE
2850|gene|hut      HDSSDERAVDLDDLIESVVEELRESFPEATIETDVPAGLAVEADDKLGDALSEAIENAIL
                   . ..   ** :: ***...*  **: .* *: .** .  *: ***.*. *:.*   **  

2158|gene|hla      HGATAVELSARAVDGGVEIAVTDDGPGIHESESRVITGRDPETQLEHASGLGLWIVRATA
2850|gene|hut      HGGGEVRVGATRHGGDVDITVTDEGPGIPEHELSSIAADAEITQLDHGTGVGLWVVRTVV
                   **.  * :.*   .*.*:*:***:**** * *   *:.    ***:*.:*:***:**:..

2158|gene|hla      DAFDGWLSIETRRAGDEGASDDETGTTVTIGVPAP
2850|gene|hut      DAYDGTLTFDT-----------EGGTTMTIRLTAG
                   **:** *:::*           * ***:** :.*