HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0269COG1111 COG1948KOG0354 KOG2379 KOG0442arCOG00872ATP-dependent RNA helicase homolog eIF-4A

HOG Organism Gene ID Name Annotation
cHOG0269 nrc1 VNG2356 erc ATP-dependent RNA helicase homolog eIF-4A
cHOG0269 hmu HMUK0800 Hmuk_0800 helicase domain protein( EC:3.6.1.- )
cHOG0269 hma RRNAC2704 eif4A Hef nuclease
cHOG0269 hwa HQ1020A Hef nuclease
cHOG0269 hla HLAC2546 Hlac_2546 ERCC4 domain protein
cHOG0269 hbo HBOR02260 Hbor_02260 ERCC4-like helicase( EC:3.6.1.- )
cHOG0269 hut HUTA1486 Huta_1486 helicase domain protein
cHOG0269 hvo HVO_3010 HVO_3010 eif4a ATP-dependent RNA helicase homolog eIF-4A
cHOG0269 nph NP0336A Hef nuclease
cHOG0269 hhi 3099 eif4A Hef nuclease/ATP-dependent RNA helicase-like protein eIF-4A
MUSCLE (3.6) multiple sequence alignment


336|gene|nph        MATAAEDTEYIEGPLLAEGLLEKRRYQLKLAETAAEDHTLVCLPTGLGKTAVSLLVTAER
2356|gene|nrc1      --MSEEMG-YVDHPMLADGVIEARQYQLQLAAAARQGHTLVCLPTGLGKTTVSLLVTAYR
1486|gene|hut       MAATDASEESIDRPLLEPGVLENRGYQIQLADAAAADHTLVCLPTGLGKTTVSLLVTAER
12704|gene|hma      MATTDAGGEHVERPLVTPEFLENRRYQTELAETASGDHTLVCLPTGLGKTTVSLLVTAER
3099|gene|hhi       MATTDAGGEHVERPLVTPEFLENRRYQTELAETASGDHTLVCLPTGLGKTTVSLLVTAER
1020|gene|hwa       MAATDDSA-YVDHPLLVSSFIEQRLYQIQLAGTARKTDTLVCLPTGLGKTTVSLLVTATR
2546|gene|hla       -MATEATG--IDRPLLVDDFLQRRRYQLQLADAAADEHTLVCLPTGLGKTTVSLLVTAER
2260|gene|hbo       MAAADDPA-HVDHPLLSPSFIERRLYQIRLASAARDAHTLVCLPTGLGKTTVSLLVTAER
                       :      :: *::   .:: * **  ** :*    ************:******* *

336|gene|nph        L-ADRGGKALLLAPTKPLVQQHAAFYREALTLADDEVVVFTGAVRPDDRAALWEDASVVC
2356|gene|nrc1      LADDAGGTALLLAPTKPLVEQHAGFYREALAIPDDDVVVFTGETRPDDRRAAWTDARVVV
1486|gene|hut       L-HAVGGKSLLLAPTKPLVQQHADFYREALTIDDEEIVVFTGEVRPDDRAALWDDATVVI
12704|gene|hma      L-NAVGGKSLMLAPTKPLVQQHAEFYREALELDDEDVVVFTGEVRPDDRAALWDDARIVI
3099|gene|hhi       L-HAVGGKALMLAPTKPLVQQHAEFYREALELDDEDVVVFTGEVRPDDRAALWEDARIVI
1020|gene|hwa       L-NSIGGTALFLAPTKPLVRQHIEFYRNALTIPDEDIVVFTGEVSPDDRAALWDDAQVVI
2546|gene|hla       L-HEVGGKALFLAPTKPLVQQHADFYREALSIPDDEIVVFTGDVKPDDRAALWNDARIVI
2260|gene|hbo       L-HEVGGKALFLAPTKPLVQQHADFYREALEIPDDEIVVFTGDVRPDDRAALWDDARIVI
                    *    **.:*:******** **  ***:** : *:::***** . **** * * ** :* 

336|gene|nph        ATPQVVENDLVGNRVSLRPVTHLTVDECHRATGDYAYNYIAERYHEDAAKPLVTAMSASP
2356|gene|nrc1      ATPQVVENDLVGGRIDMDDVVHCTFDECHRATGDYAYTYVAERYHADAAAPLVTAMSASP
1486|gene|hut       ATPQVVENDLLGSRIDLSPVTHCTFDECHRASGEYPYTYIAERYHEDSDDPLVTGMSASP
12704|gene|hma      ATPQVVENDLVGNRISLADVTHCTFDECHRATGDYAYNYIADRYHADAENPLVTGMSASP
3099|gene|hhi       ATPQVVENDLVGNRISLADVTHCTFDECHRATGDYAYNYIADRYHADAENPLVTGMSASP
1020|gene|hwa       ATPQVIENDLIGNRISLNSVTHLTFDECHRATGEYAYVYIAERYHDDATNPRVTGMSASP
2546|gene|hla       ATPQVVENDLVGNRISLRDVTHCTFDECHRATGDYAYVYIAERYHADAADPLVTGMSASP
2260|gene|hbo       ATPQVVENDLIGNRISLREVTHLTFDECHRGTGDYAYVYIAERYHADAERPLVTGMSASP
                    *****:****:*.*:.:  *.* *.*****.:*:*.* *:*:*** *:  * **.*****

336|gene|nph        GGDKEEILTVCDNLGLREVAVMTEADADVDEYTHHTDVEWERVELPEAVIDIRDNLNEVI
2356|gene|nrc1      GGTEAEIRTVCENLGVGNVEVMTEDDADVGEHTHDTDVQWERVTLPEEILEVRDAINDVI
1486|gene|hut       GDDEEAILGVCDNLGIREVEVMTSEDADVEAYTHNTSVNWERVELPEPVIEIRDALQDVI
12704|gene|hma      GDDEEAILEVCENLGLSDVAVMTENDADVAEYTHDTSVDWKRIELPEVVVEIRDAINEVI
3099|gene|hhi       GDDEEAILEVCENLGLNEVAVMTENDADVAEYTHDTSVDWNRIELPDIVVEIRDAINEVI
1020|gene|hwa       GSDKEGIVTVCNNIGVSAVEVMTEDDADVAEYTYTTDVEWKHIELPDEIIQIRDALNDVI
2546|gene|hla       GGDTEEIETVCENLGLSNVEVMTEEDADVDEYTHDTDVQWEQVTLPDEVIAIRDALNEVI
2260|gene|hbo       GGDKESILEVCENLGLVEVEVMTEEDADVDEYTYDTDVEWERIQLPDEILAIRDAVNEVI
                    *.    *  **:*:*:  * ***. ****  :*: *.*:*:.: **: :: :** :::**

336|gene|nph        TERLTKLKELGVTTSTDPNMSQSQLNAIRAKLQELINNDDSSGYKGMSAHAEIMKLRRAV
2356|gene|nrc1      EDRLAKLREIGVTKASSPDISQKDLNEIRARLQQLIDDDDSDGYQGMSVHAEVMKLKRAV
1486|gene|hut       HDRMTQLKELGVTSSTQADVSEREIRKIQAKLRELMDNDQSEGYQGMSLLAEVRKLRTAV
12704|gene|hma      KDRLSQLKELGVTNKSSADISEREIQQIQGQLRDLMNNDQSEGYQGMSLLAEIRKLRTAV
3099|gene|hhi       EDRLDQLRELGVTNKSSADISEREIQQIQGQLRDLMNNDQSEGYQGMSFLAEVRKLRTAV
1020|gene|hwa       RDRLQQLKSLGVADTTQPDVSQKQLNQMRGKLQKLIDADNSDGYAGMSTHAEVMKLRRAV
2546|gene|hla       TDRLEKLKSLGVTNKTSPDLSQRDLNEMRGKLKKMMDNDQSDGYKGMSTHAEVMKLRRAT
2260|gene|hbo       KDRLEKLKSLGVTNTTSPDVSQKQLNGMRAELQKLMNNDQSEGYKGMSTHAEVMKLRRAV
                     :*: :*..:**:  :..::*: ::. :.. *..::: *:*.** ***  **: **. *.

336|gene|nph        ELVETQSVESVRRYFERQREDAKSSGASKASQRFVSEPRVQAAMRKATAFDDLHPKFRRT
2356|gene|nrc1      ELVETQSVESVRRYFERQRNAANTAGASKASQRLVSEPAVKRAMRTAREFDGLHPKFRQA
1486|gene|hut       TYAETQSVESLRRYLERLREAARSSGASKADQRLISAPKVREARRKAEDFEDLHPKFRRT
12704|gene|hma      TYVETQSVESLRRYFERLKEAARSSGASKADQRLVSEPKVREAMRKAESYNDLHPKFRQT
3099|gene|hhi       TYVETQSVESLRRYFERLKEAARSSGASKADQRLVSEPKVREAMRKASDYDDLHPKFRQT
1020|gene|hwa       ELVETQSVESVRRYFERQRNAAQSSGASKASQRLIAEPKVRQSMQLAESFDGTHPKFSRT
2546|gene|hla       ELVETQSVESVRRYFERQREAARSSGASKASQRMVADPKVREAMRKAEAFDGLHPKFSKA
2260|gene|hbo       ELVETQSVESVRRYFERQRNAARSSGASKASQRLVAEPKVREAMRKAESFDGLHPKFSQT
                      .*******:***:** .: *.::*****.**::: * *. : . *  ::. **** .:

336|gene|nph        RILLAQTLGIEGGERVIVFTESRDTAESLTAFLGEHFETRRFVGQGDKDGSDGMTQTEQK
2356|gene|nrc1      RMLLAETLGIEDGDRVIVFTESRDTAEALTAFLGEHFDTRRFVGQGDADGSDGMTQTEQR
1486|gene|hut       RMQIAETLGIHDGERVIVFTESRDTAETLTDFLGEHFSVEKFVGQSDTDGSDGMTQTEQQ
12704|gene|hma      RMLLAETLGIENGERVIVFTESRDTAETLVDFLSDHFTTQKFVGQSDTDGSEGMTQTQQQ
3099|gene|hhi       RMLLAETLGIENGERVIVFTESRDTAETLVDFLSDHFTTQKFVGQSDTDGSEGMSQSQQQ
1020|gene|hwa       RILLAQTLGIEGGERVIIFTESRDTAEALTEFLSASFDVQRFVGQNDTGRSEGMTQREQQ
2546|gene|hla       RILLAETLGINEGERAILFTESRDTAEALVEFLSTSFDVRKFVGQGDKEGSDGMSQKQQQ
2260|gene|hbo       RILLAQTLGIQDGERVIVFTESRDTAEALTDFLSESFDARRFVGQGDKEGSDGMTQKEQQ
                    *: :*:****  *:*.*:*********:*. **.  * . .****.*   *:**:* :*.

336|gene|nph        ETLDAFRSGEFEVLVSTSVAEEGLDVPDVDLVLFYEPVPKGIRSIQRKGRTGRASDGRVV
2356|gene|nrc1      ETLAEFRNGDFEVLVSTSVAEEGLDVPEVDLVLFFEPVPTAIRSVQRKGRTGRQTAGRVV
1486|gene|hut       ETLEAFRAGEFEVLVSTSVAEEGLDVPEVDLVLFYEPVPTAIRSIQRKGRTGRQTEGAVV
12704|gene|hma      ETLDRFRNGEFEVLVSTSVAEEGLDVPEVDLVLFYEPVPTAIRAIQRKGRTGRQAEGRVV
3099|gene|hhi       ETLDRFRDGEFEVLVSTSVAEEGLDVPEVDLVLFYEPVPTAIRAIQRKGRTGRQAEGRVV
1020|gene|hwa       KALTAFRSGEFEVLISTSVAEEGLDVPEVDLVLFFEPVPTAIRSIQRKGRTGRQTEGRVV
2546|gene|hla       ETLDEFKAGDFEVLVSTSVAEEGLDVPEVDLVCFYEPVPTAIRSIQRKGRTGRQAEGKVV
2260|gene|hbo       ETLDEFRNGEFEVLVSTSVAEEGLDVPEVDLVLFFEPVPTAIRSIQRKGRTGRQAEGRVI
                    ::*  *. *:****:************:**** *:****..**::******** : * *:

336|gene|nph        VLLAEDTRDEAFFWMSRNEEKRMEEELRKLKSIEGEIEAEI--A--QADLGSFAEAPPEG
2356|gene|nrc1      VLLAEDTRDEAYFWISRRREQEMTEELQSLKGRADELETELGGDGAQQALDEFGDAEAAG
1486|gene|hut       VLIAEDTRDEAYFWKARQDEKRMEDELRTLKDMAGDIESHL--RE-QMGLEGYGEASADS
12704|gene|hma      VLLAEDTRDEAYFWKARNDQKRMKRELNELKSVAGELEARL--D--QTGLDEYEDTTGTA
3099|gene|hhi       VLLAEDTRDEAYFWKARNDQKRMKRELNELKSVAGELEARL--D--QTGLDEYEDGEGTA
1020|gene|hwa       VLLAEDTRDEAYFWISRRRQKKMESELRSLKQSVDDIESSI--ISPQEELTTYNHDSSTE
2546|gene|hla       VLMAEDTRDEAFFWISRRREKKMASQLAELKEATDDIEETV--DDGQAGLDAFAGG-SAG
2260|gene|hbo       VLMAENTRDEAYFWISRRREKEMKSELRDLKGVADEVEEEL--DDSQKGLDAFSGGDSAG
                    **:**:*****:** :*. :: *  :*  **   .::*  :     *  *  :       

336|gene|nph        SEESEHTAEDEAESGEAEPPDSGGGES-----NDGNQAETSGDTAEVAPDTDSNGGD---
2356|gene|nrc1      EEPAA-----------------------------------------PAPEDVSDGED---
1486|gene|hut       DDTAA-GNDTADSAGE----------------TTDDPADADDDDEQAVQGAADDAED---
12704|gene|hma      SSGTG-DGETTRQSGGSTGNGRGSGAN--KSAEDDDGSDGQAGLDAFADDRSEAADADAG
3099|gene|hhi       SGGTS-EDETATQSGDSTRNKRGSGAN--KSVEDDDGSDGQAGLDAFADDPSEAAEV---
1020|gene|hwa       TDAKASDEDTDVETDSDSDSDSDSDSNISKQKIADSAKDSQSGITDFAPSDSELSNT---
2546|gene|hla       NDTKP-EADNSAADSDDGGDDDNTDAG-----LTDFAAEARDGDADGEDNDDDGGDE---
2260|gene|hbo       TDDGE-SSGAIANGGTAAATTETPDAS-----TAEADSGTDGGTASGTDATDTNSND---
                                                                          .     

336|gene|nph        ----AAEPAEDADRQVGLTDFAAEADGTDTDEAGTVATAAPEGE--TVEIVADQRELDSH
2356|gene|nrc1      ----------------------TEGVAARVDGAGEA-----------VEVVVDQRELDST
1486|gene|hut       DGQTGLDAFAPGDDDATESP--TEQTDPEPDEEGTVATAGGEEA---VEVVIDQRELDAS
12704|gene|hma      AAEGDSEAASVDEGDTGTAD--GGESTGTADDEGTVATAGRDDEDDPVEIVADQRELDSN
3099|gene|hhi       ------------DSEAATAN---EENTGTGDDEGTVASAGRDDEDDPVEIVADQRELDSN
1020|gene|hwa       ETETEAQSAETASEEVYSTD--IETNTAVSESPPTPDVDISEDT---IEIVVDQRELDST
2546|gene|hla       -SDGGDESEGDSDDA---GE--VEASEGDSDDAGVVATAGVDEG---VEVVVDQRELDST
2260|gene|hbo       -DQAGLDSFSASDEEIARAD--EESEAAVEDGDGTVATAGRDDE--VVEIVVDQRELDSN
                                                  :                :*:* ******: 

336|gene|nph        IARDLSMRDGVETRLETLAVGDYVLSDRVVVERKAVEDFLETLVGGDRSMFEQVGAAARH
2356|gene|nrc1      IARELSKRDGVETRLETLAVGDYVVSDRVAVERKSHSDFMDTLLGSERSIFEQAKELARQ
1486|gene|hut       IGRDLSRRDGFETRLETLDVGDYVLSDRVVVERKTISDFLDTLTGGDRSMFEQVKDDARY
12704|gene|hma      IARDLSTRDGIETRLETLAVGDYVLSDRVVVERKTVADFMDTLTGGDRSMFEQVGDATRN
3099|gene|hhi       IARDLSTRDGIETRLETLAVGDYVLSDRVVVERKTVADFMDTLTGGDRSMFEQVGDATRN
1020|gene|hwa       VPRSLSTRDAIQTRLETLAVGDYVLSDRVAVERKSATDFLDTLLDGNRSLFEQTGDLVRA
2546|gene|hla       IAKDLSTRDGLVTRLETLAVGDYVLSDRVAVERKSAADFVDSMLDSDRSMFEQVGELSRA
2260|gene|hbo       IAKDLSTRDGIETRLETLAVGDYVLSDRVAVERKSVSDFLDTLTGGDRSLFEQIGDLSRA
                    : ..** **.. ****** *****:****.****:  **:::: ..:**:***     * 

336|gene|nph        YGRPVVIIEGE--GLYERRNVHPNAIRGAVASLAVDFGASVLRTTDTDETADLLEVIATR
2356|gene|nrc1      YTRPVLVVEGD-GDLYAERNVHPNAVRSAMASLAVDWGLSVMHTNGEGDTTEMIETIAER
1486|gene|hut       YDRPVVILEGD--GLYEERNVHPNAIRGALASLAVDFGASVLRTEDEGETADLLATIATR
12704|gene|hma      YGRPVVIIEGE--DLFGARNVHHKAIQGALASLAVDFGASVLRTSDEDETADLLEVIAGR
3099|gene|hhi       YGRPVVVIEGE--DLFGARNVHHKAIQGALASLAVDFGASVLRTSDEDETADLLEVIAGR
1020|gene|hwa       YGRPVLILEGELTTLYTERNIDPSAIQGALASLAVDFDISILQTRDDSDTADMLETIATR
2546|gene|hla       YARPVMVVEGT--NLYGQRDIDPNAIRGALASLAVDFDVSVLRTEGESDTTELLATIAKR
2260|gene|hbo       YARPILILEGE--GLFEERNIHPGAIRGALASLAVDFDVSVLQTRDEDDTAELLLTIATR
                    * **::::**    *:  *::   *:..*:******:. *::.* . .:*:::: .** *

336|gene|nph        EQETDDRSVSVHGEKGGKTLAEKQEYVVSAVAEVGPVTARALLEHFGSVEAVMSADEEAL
2356|gene|nrc1      EQTTNDRAVSAHGEKAAKTQGEQQEYVVSSITDVGPVTARSLLDTFGSVEAVMTASEDEL
1486|gene|hut       EQETDDREISVHGEKGSKTLPEQQAYVVASIADVGPVIARTLLEHFGSVQAVMTANEDDL
12704|gene|hma      EQETADREVSVHGEKQSKTLPEQQEYVVAAIAEVGPVTARTLLESFGSVEAVMTADKDDL
3099|gene|hhi       EQEVADREVSVHGEKQSKTLPEQQEYVVAAIAEVGPVTARTLLEAFGSVEAVMTADKDDL
1020|gene|hwa       EQTSRDRSISVHGEKSAKTLQEQQEYVVSSIADIGPVTAQSLLDAFGTVEAVMTAGEDDL
2546|gene|hla       EQETRDREVSVHGEKTAKTRAEQQEYVVSSIADIGPVTARTLLEHFGTVEAVMTAPEDDL
2260|gene|hbo       EQTERERSVSVHGGKSTKTLSEQQEYVVSAIADIGPVTARSLLEEFGTVEAVMTAREEDL
                    **   :* :*.** *  **  *:* ***::::::*** *.:**: **:*:***:* :: *

336|gene|nph        QAVDGVGDVTAERIRDVTGTTYADSS
2356|gene|nrc1      TAADGVGAVTAERIRGVVGTEYQPE-
1486|gene|hut       LDVDGVGEVTAERIREVVGSEYEG--
12704|gene|hma      LEVSGIGDVTADRIREVIASDYEP--
3099|gene|hhi       LEVSGIGDVTADRIREVIASDYDP--
1020|gene|hwa       TAVDGVGAVTAARIRDVVGSNYS---
2546|gene|hla       LEVDGVGPVTAERIREVVGSEYE---
2260|gene|hbo       LEVSGIGSVTAERIRDVIGSEYE---
                      ..*:* *** *** * .: *