HOG Organism Gene ID Name Annotation
aHOG2684 hbo HBOR11640 Hbor_11640 hypothetical protein
aHOG2684 hla HLAC0993 Hlac_993 hypothetical protein
aHOG2684 hmu HMUK2130 Hmuk_2130 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


11640|hp|hbo      MSLARHSETVELDDQTYLVRPFQSDDESGLRGVYESVSGRDPGHEWFETMYGSESLFEDA
993|hp|hla        ---MQQVDATDEGDD-YSIRAGGSGDREAFLSLYESVWGRSKSAAWFDWRFVDNPFTDRV
                      .: ::.: .*: * :*.  *.* ..: .:**** **. .  **:  : .:.: : .

11640|hp|hbo      PIVVIEFEGDIVGMLPSVAYRVRVGEKSAIGLLGRDVMVHPEHRRRGVFTAATNVALGGY
993|hp|hla        ELVIAECAGRVVGAEPLLALPLATPAGTVPVRQPVDWIVHSDHRQCGLFTRMTEQLLSTT
                   :*: *  * :**  * :*  : .   :.      * :**.:**. *:**  *:  *.  

11640|hp|hbo      LDYGEATFIFGHMNEQSRQACEEMGWNIPSMQPQFIRPRNVRDFVRTRTGQNRSLRGALT
993|hp|hla        AE--RAELLFNFPSDALRPGLQKFDWTEVASVPMRYRVQNAAGISASLTDDDHDTSVLTR
                   :   * ::*.. .:  * . :::.*.  :  *   * .*. .:  : *.::..      

11640|hp|hbo      ATTLAGNTLVHDAVRRERGLCRPTDTLDVQRVDGVPADRLTRLHETATPETIHPIFDVQT
993|hp|hla        AATPAVRAVLAVADR----LTSSMADVSAQRVDGTATHAIRSVYTETRPDTVHVPRTTTY
                  *:* * .:::  * *    *  .   :..*****..:  :  ::  : *:*:*    .  

11640|hp|hbo      IRAHFSDPDFTGLRTYVAARGGSDVAALVVSERRWHRTRWHSIVHVAPLSGGKTRKRALA
993|hp|hla        LDWRFANPRW-DVATYVARRGGRPVATLVVGRETVDGTEKALLLDVQPMTTDPERAPAFA
                  :  .*::* : .: **** ***  **:***.      * .  :: * *:: .  *  *:*

11640|hp|hbo      ALLERALTDKKGSDSATSADAYRVAVPFPSDLLRSFGFLSDRTFPMSRLEPPRLSLGYRV
993|hp|hla        AALDAALADLADVDVVTAP-----ARVFPG-VLRHRGFLRDDSFPLARFATTTTHVVRPL
                  * *: **:*  . * .*:.     *  **. :**  *** * :**::*: ..   :   :

11640|hp|hbo      IN--DGHGIRAALADDSHHLWHVAM------
993|hp|hla        PDPTDTSGFDADVFDADA--WTLMLADLDVE
                   :  *  *: * : * .   * : :