HOG Organism Gene ID Name Annotation
aHOG2678 hla HLAC1767 Hlac_1767 hypothetical protein
aHOG2678 hmu HMUK2092 Hmuk_2092 conserved hypothetical protein
>1767|hp|hla !!AA_SEQUENCE 1.0
MPDAFGRAIRDHHRGDRTTPLRQGDGEETREHPIGAFYFDAFDAESNAGSWLTSRLSGPL
VDLGAGAGRHALRFQGRFETVAVETSPALVEAMRDRGVVDVREGDMFALRDAFERDRFAS
ALAIGTQIGLAGSMRGLSAFLGDLAFVTTPGATAVIDSYDPDHPGAADLLGYREDPTPGL
AHRVMWFAYDGETDPTLHFRLFAPDRLREAAIGTGWEVEAVDREGTGDGPHYRAALRKR