HOG Organism Gene ID Name Annotation
aHOG2666 hla HLAC1606 Hlac_1606 transposase IS4 family protein
aHOG2666 hla HLAC1607 Hlac_1607 Cupin 2 conserved barrel domain protein
aHOG2666 hmu HMUK2193 Hmuk_2193 Cupin 2 conserved barrel domain protein
aHOG2666 hma Hma_10977 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1606|gene|hla      MFTIPDPDEYLSASDVKDVAEEVITPLPLPGVEGSPLDPGDIWLVVILACTNQNSIWDTC
1607|chp|hla       ------------------------------------------------------------
10977|hp|hma       ------------------------------------------------------------
                                                                               

1606|gene|hla      NDTEGTPCDDTVLRWLHTLNRQWLEVVANLLLARLAMTIFDPDRSRTVSIDFIDNPYHGE
1607|chp|hla       ----MIRVTESDLDWTDTE--------------------------------------RGE
10977|hp|hma       --MSNGPVNEADLDWTDHE--------------------------------------HGD
                            :: * *                                          .*:

1606|gene|hla      HHAEKGELCSMAPKDGTTTCHRYCTAYVVSNGKPVTLAMTYVRSDEDEADAVERVLARVE
1607|chp|hla       TRFRRKQLAEAADGDRIG-----CSLYELPAGAK-SWPYHYHTANEEAI-----------
10977|hp|hma       RTFKRKQIGDAAGGEQLG-----ASLYAVPPGKR-LWVRHYHEGNEEAI-----------
                       . :: . *  :        .: * :. *        *  .:*:             

1606|gene|hla      NYPFEIDLLLADSGFYNERVIRRARDIAPTVVHVPKKGERMKDKLETHKSYMTTYRMYKD
1607|chp|hla       -------YVLSGSA---------------------------------------TLR--HD
10977|hp|hma       -------FVRGGTG---------------------------------------TLRLGPE
                           : ..:.                                       * *   :

1606|gene|hla      SERELRFPLAVAVSYQNGDRGKHGEVVRGYVACGVTDRSAKQVEHRYRKRSGIETTYRLL
1607|chp|hla       GE-TVRIEAGDYVAFPADESGAHRVVNEG------------------------DDSVRYL
10977|hp|hma       AD-EHALEPGDYVALPAGEESAH-EIEAG------------------------ESELRLL
                   .:    :  .  *:   .: . *  :  *                        :   * *

1606|gene|hla      RQARGITTTRDP-VVRFAIMLVAALLENLWLVLRWAVVARPRRGGRDLPEEFTFKTFCDW
1607|chp|hla       ----AMSTMTEPDVTVYPDSETFGVF-----------VGSPPGG-REE------RSLSGY
10977|hp|hma       ----MVSTMEEPDITVYPDREMVGLY-----------AGSPPGGEKAD------RTLSTY
                        ::*  :* :. :.     .:            .. *  * .        .::. :

1606|gene|hla      IRHELEEELRRRWKIKANGVGVPASQATAAG
1607|chp|hla       YQIDDTVDY---WEL----------------
10977|hp|hma       LDRNAEKEY---WEE----------------
                      :   :    *: