HOG Organism Gene ID Name Annotation
aHOG2662 hbo HBOR25670 Hbor_25670 hypothetical protein
aHOG2662 hla HLAC1673 Hlac_1673 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


25670|hp|hbo      MNALAVEQTDERTGQTRRIDVTEFRTVRVADYARTR--FDGDVRFERCAGTTYLIAADRR
1673|hp|hla       MSATSHDRP--RYATPTRVDVTECRTNRIADRARLNRVQDSEVHLERRGGRTFLVTTPAE
                  *.* : :..  * . . *:**** ** *:** ** .   *.:*.:** .* *:*:::