HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0266COG0373arCOG01036Glutamyl-tRNA reductaseglutamyl-tRNA reductase

HOG Organism Gene ID Name Annotation
cHOG0266 nrc1 VNG1774 hemA glutamyl-tRNA reductase
cHOG0266 hmu HMUK1612 Hmuk_1612 glutamyl-tRNA reductase( EC:1.2.1.70 )
cHOG0266 hma RRNAC1708 hemA glutamyl-tRNA reductase
cHOG0266 hwa HQ3336A hemA glutamyl-tRNA reductase
cHOG0266 hla HLAC2132 Hlac_2132 glutamyl-tRNA reductase
cHOG0266 hbo HBOR07260 Hbor_07260 glutamyl-tRNA reductase( EC:1.2.1.70 )
cHOG0266 hut HUTA2825 Huta_2825 glutamyl-tRNA reductase
cHOG0266 hvo HVO_2311 HVO_2311 hemA glutamyl-tRNA reductase
cHOG0266 nph NP4502A hemA glutamyl-tRNA reductase
cHOG0266 hhi 2243 hemA2 glutamyl-tRNA reductase
MUSCLE (3.6) multiple sequence alignment


4502|gene|nph       MTVETGIVVGASVSHSHASIDQIETAADGSQQTAVEELLSKEGVSEAFVLQTCNRAEAYV
1774|gene|nrc1      MNGNTGVVSGVRVSHETASLDELAAASAASTEAALDALLEQPPVEEAFVLQTCHRVEAYV
2825|gene|hut       -MKEPGYITAASVAHQHGSVEDIDAAAADSQLAGVEQLLEAPHVTEAFVLQTCNRAERYV
11708|gene|hma      MRGDTGAIVGVCISHERASVDQLETAAADSERHAVESLLANPAVEEAIALQTCNRTEGYV
2243|gene|hhi       MRGDTGAIVGVCISHERASVDQLETAAADSERHAVESLLANPEVEEAIALQTCNRTEGYV
2132|gene|hla       -MKETGAITGISVAYSRATVDEIEAAGGDGVRATVSDLLARDGVEEAFAIQTCNRSEAYV
3336|gene|hwa       --MNTGVICGVRVSHNRASVEEIELAGERDSRTIMETLLTRDGITESFAIQTCNRSEAYV
7260|gene|hbo       -MRNAGVISGVRVSHDHATVDEVASASDDDVRTTVESLLTNEEVSEAFALHTCNRAEAYV
                       :.* : .  :::. .:::::  *.  .    :. **    : *::.::**:* * **

4502|gene|nph       VANDSETGTAALAGYLAGVDDDAIRMLSHNQSLKHLMAVACGLESLVIGEDQILGQVRDA
1774|gene|nrc1      VTADQASGRRALGGAGFNPAGGGAISMGHEDSLRHLLRVAAGLESLVVGEDQILGQLRDA
2825|gene|hut       VSDDPEAGRAALQAAMPDEVDSTVRTLGHEESLRHLLRVAAGLESLVPGEDQILGQVRDA
11708|gene|hma      VVSDHEDGLEALELFTRAVPDDVVVEMGHEESLRHLLRVAAGLESIVLGEDQILGQLRTA
2243|gene|hhi       VVSDHADGLDALELFTRAVPEDVVVEMGHEESLRHLLRVAAGLESIVLGEDQILGQLRTA
2132|gene|hla       VTDRTIDGSVALESFAPEVRGGAVRRLDHEESLEHLMRVASGLESLVLGEDQIIGQLREA
3336|gene|hwa       VADGAVAGRRALASFAPDVRDGAVVDMSHEESLRHLLRVATGLESLVLGEDQILGQFKRA
7260|gene|hbo       VTDAQATGRRALTDFAPDVRDGAVVEMDHEQSLRHLMRVAAGLESLVLGEDQILGQIKRS
                    *      *  **         .    :.*::** **: ** ****:* *****:**.. :

4502|gene|nph       YEDARGVGGVGPTLNDAVLKALHVGERARTETAINEGAVSLGSAAVRFAAERHGVTGSTA
1774|gene|nrc1      YDAAKDAGGIDHVLREAVTKAMHVGERARTETAINEGATSLGTAAVRLAERKTQLADARA
2825|gene|hut       YEDARHVDGLGPVLEEAVTKAIHVGERARTETAINEGVVSLGSAAVELAERERDLEAATA
11708|gene|hma      YETARGVGGIGPMLEDGVTKAIHVGERARTETKINEGVVSIASAAVRLLKQESSLTDGTA
2243|gene|hhi       YETARGVGGIGPMLEDGVTKAIHVGERARTETKINEGVVSIASAAVRLLKQESSLTDGTA
2132|gene|hla       YEESKSAGGIGPVLKDGVTKALHVGERARNETSINEGVVSLGSAAVRLAADEIDLTDGSA
3336|gene|hwa       IEVARGIGALGPMLEAGVTKAIHVGERARSETSINEGAVSIGSAAVRLAGQSVGLNGRKA
7260|gene|hbo       FEEARGAGGIGPMLDDAVTKAIHVGERARTETEINEGALSLGSAAVRLAKSETTLDGATA
                     : :.  ..:.  *  .* **:*******.** ****. *:.:*** :      :    *

4502|gene|nph       LVVGAGEMATLAAKALD--DPASRVIVANRTRERAERLAEELSTTASVVGVDSVDEAADA
1774|gene|nrc1      VVVGAGEMGALAAKAFAS-ATVAEIVIANRTPARAVRVADMVSVPAEATTLADARGRLDA
2825|gene|hut       LVIGAGEIGTLAAKAVDARSDVAHLYVANRTVPHAEHVTSIVDVAASAIGLDDVASVVDR
11708|gene|hma      LVVGAGEMGQLAAEALS--EEVDRLLVANRTVPHAEHIAESVDIDASALALDGIEAAVSE
2243|gene|hhi       LVVGAGEMGQLAADALS--EEVDRLLVANRTVPHAEHVAESVDIDASAVALDGIEAAVSE
2132|gene|hla       VVVGAGEMGTLAARTLDD-TPVSEIVVANRTVPNAAFVAEEVETPAEAVPLADLATVIPD
3336|gene|hwa       LVIGAGEMGSLVAESLAS-TNISEVVIANRTIENAESIAETINSPAYAVSLDSLTEVITE
7260|gene|hbo       LVIGAGEMGTLAAESLAA-AGIGELVVANRTLPHAEHVAEEVDVPARALPLSAVEAAIEA
                    :*:****:. *.* :.        : :****  .*  ::. :.  * .  :         

4502|gene|nph       ADVVVSATGSEDYVIDTADLGGVGETCVLDIAQPRDVAPGADGIDGVAVYDLDTIESVTD
1774|gene|nrc1      ADVVVTATGSPEHVLPASAFADAGDTVVVDLAQPRDVAPGAGGHDGVAVHDLDDLEAVTA
2825|gene|hut       ADLVVSATGSADPIVEPAAFETTGDTVVIDIGQPRDIPPIVDEQPGTDVFDLDDLEAVTA
11708|gene|hma      ASAVISATGSGDQVFDIGTFSDSGDVSIVDIAQPRDVPAGADRLPSVTVYDLDALESVTA
2243|gene|hhi       ASAVISATGSGDQVFDIGTFSDAGDVSIVDIAQPRDVPAGADRLPSVTVYDLDALESVTA
2132|gene|hla       ADLVIAATGSPDPVIRSEHVTGADRLVCIDIAQPRDIEPALADRDKVTLYDIDALEDVTR
3336|gene|hwa       ASIIMTATGYGKYLIEPTDIDGAGETFIIDLAQPRNVHPATADIENAIVQDIDALESITK
7260|gene|hbo       ADVVISATGSPEYVLSSPHVETSGETTLIDLAQPRDVDPAVDSLPDIVVHDMDGLEAVTD
                    *. :::***  . :.    .   .    :*:.***:: .         : *:* :* :* 

4502|gene|nph       EARAKRREAAETVETMIDEEFEHLMTQYKRKRADQVIAAMYEGAERIKARELRTAVSKFE
1774|gene|nrc1      ATRERREDAAREVEAMIETEFERLLTQYKRKRADEVIARMYESADRLKSREVQTAVHRLE
2825|gene|hut       ETRANREAAAARVEDIVEDELAHLLTRYKRTRADDVISTMYESAERVKAREVEQALGSLD
11708|gene|hma      ETRNKRQRAAEAVERIVDEEFDRLLTQYKRKRADRVISTMYESAEQVKAAEINSALSAAD
2243|gene|hhi       ETRNKRQRAAEAVERIVDEEFDRLLTQYKRKRADRVISTMYESAEQVKAAEINSALSAAD
2132|gene|hla       KTRESREEEAREVEAIIDEELDRILEAYKRKRADNAISAMYAGADRVKAREVDRAVSKLE
3336|gene|hwa       ETEASRQAAAREVDAMIDEEFDRLLESYKRQRADEAISEMYEAAEHVKRREVETALEKLE
7260|gene|hbo       ETRELRREAAERVESMIDDEFERLLKSFKRKRADRAISGMYEAAEEVKQRELETALAKLD
                     :   *   *  *: ::: *: .::  :** *** .*: ** .*: :*  *:  *:   :

4502|gene|nph       AEREDGLSEREHEIVESMADALVGQLLSAPTQSLRDAAEEDDWATINAALQLFGPGLE--
1774|gene|nrc1      AE-SGSLSADEREVVESMADALVSQLLAAPTKSLRDAAAEDDWSTIATALELFNPEF---
2825|gene|hut       ------LDDEEREVVEAMADSLVNQLLAAPTKSLRDAAEADDWATIDTALALFDPDFG--
11708|gene|hma      ------FDDEQAEVVEAMADAIVSQILAAPTKSLRDAAEEDDWSTIHTALQLFDPDFGG-
2243|gene|hhi       ------FDDDQAEVVEAMADAIVSQILAAPTKSLRDAAEEDDWSTIHTALQLFDPDFGG-
2132|gene|hla       AQ--GGLTDEQRETVEDLADALVGQLLAAPTRSLRDAAGEDDWETIRTALRLFDPEFDTL
3336|gene|hwa       KQ--GTLTDNQRETISSMADTLINQLLAAPTKSLRDAAAEDDWTTIQTAMTLFDPNFGGD
7260|gene|hbo       AQ--GELTDDQRETVAALADALVGQLLSAPTKSLREAAVEDDWDTIQTAMTLFDPDFSGG
                          :   : * :  :**:::.*:*:***.***:**  *** ** :*: **.* :   

4502|gene|nph       -PEPTELPTVPDG--PEGVP-EELRERMSSGMLEQFSTNDD
1774|gene|nrc1      --EDGMPFDASRGGDAASAE----------------S--ED
2825|gene|hut       --ETEFPP------SVADVD-ADVPDRFSR-LVD--A--DD
11708|gene|hma      -PDQATPPEFTKGMSVEDIP-DGMRDEIPNAMLDRLS--DD
2243|gene|hhi       -PDQATPPEFTQGMSVDDIP-DGMRDEIPNAMLDRLS--DD
2132|gene|hla       -PEGPGASGSGHDAAPGDIE-------VPPGSVAEEL--DD
3336|gene|hwa       TPQPDRPDDIPRAAERGDISGDDLPDDVPNHIAEKVS--DG
7260|gene|hbo       EPSFDTPSG-PRGAIPEDAS-NDADD--GQHVLESLA--DD
                      .              .                     :.