HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0265COG1645arCOG00578Uncharacterized Zn-finger containing proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0265 nrc1 VNG2366 vng2366 no entry
cHOG0265 hmu HMUK0802 Hmuk_0802 Sjogrens syndrome scleroderma autoantigen 1
cHOG0265 hma RRNAC2705 hypothetical protein
cHOG0265 hwa HQ3458A hypothetical protein
cHOG0265 hla HLAC2246 Hlac_2246 Sjogrens syndrome scleroderma autoantigen 1
cHOG0265 hbo HBOR02290 Hbor_02290 uncharacterized Zn-finger containing protein
cHOG0265 hut HUTA1099 Huta_1099 Sjogrens syndrome scleroderma autoantigen 1
cHOG0265 hvo HVO_3008 HVO_3008 Uncharacterised protein family (UPF0148) family
cHOG0265 nph NP0338A hypothetical protein
cHOG0265 hhi 3100 HAH_3100 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


338|hp|nph         ---MSD-FDREKEREKLREKYEQDKQKREASERMSELLLQGATMTNRHCPECHSPVFRHE
2290|hp|hbo        ---MSD-FDKEAERQRLREKYEKDTERRQETQRMSELLLQGATMSNKHCNECGTPIFRYQ
3458|hp|hwa        ---MSD-FDEEAERERLREKYEKNADRRAETQQMSELLLKGATMTNAHCETCGSPIFRYE
12705|hp|hma       ---MSD-FDKEAEREKLREKFEQEEDNRAATEQMSELLLKGATMTNAHCSECGDPIFRHD
3100|hp|hhi        ---MSD-FDKEAEREKLREKFEQEEDNRAATEQMSELLLKGATMTNAHCSECGDPIFRYD
1099|gene|hut      ---MSD-FDEEAERERLREQFEQDRKKREATEQMSELLLQGATMTDTHCETCGDPIFRYD
2366|chp|nrc1      MSNTDDGFDKEAAREELREKYNADQQDREETARMSDLLLQGATMTNDHCDRCGTPLFRHD
2246|gene|hla      ---MSDGFDKEAEREKLREKLADDDEKREHTQRMSELLLQGATMTNRHCDDCGDPIFRHD
                       .* ** *  *: ***:   : . *  : .**:***:****:: **  *  *:**::

338|hp|nph         GQEFCPTCQQVVTED----GDLVDPADAGAGADTGADSEAGSNAS---------PDTDAQ
2290|hp|hbo        GAEFCPTCQDKQAKADAEQGEAANVANGQGVDGTTQAAETGEQA----------------
3458|hp|hwa        GQEFCPTCQSRNTERGAADNGSVQASDSGGNAASNNDSQNASANSSSNGQANNQSSTEAH
12705|hp|hma       GQEFCPTCQKPVARDTQASGADPSDADEQEGQ-TDDGDQIEVADPSDEARVQFGDGD---
3100|hp|hhi        GQEFCPTCQKPVARDAQADGAETDDGDEETADSTGDGDNIEMAAPSDEARVQFGDDSNEP
1099|gene|hut      GQEFCPTCQQ-AAGENAADGTNAGDGADDTATADDGTPETQSAA----------------
2366|chp|nrc1      GETFCPTCQH-------------DDNDDEPTATTQSAPD---------------------
2246|gene|hla      GQEFCPSCQAIGSGDGAR-GESQESAQTAALEEAGNAPRTVVKTG---------------
                   *  ***:**                                                   

338|hp|nph         TDTDAEPAPSADAHEPSASEAAPERGRDPGADAPAEAEPEPDVDRRPATTDERRPARVDP
2290|hp|hbo        ----------------DSESPAPE-------HAADASQSGNETAEAVTTPDATGVSKPAS
3458|hp|hwa        TQADATAAPESSLADQTNTASSAN---VDRSDTSPTVEP-VETAVQTNTSNSTQSQSASD
12705|hp|hma       ----------------EAAASAPD-------TTDDSTAP-PEAGGAQSTRQSDHSEPASQ
3100|hp|hhi        DQTAAEAGAADGQTTPDAAPSAPQEPSQSDSSTNASHSP-PEAGGDRTTQPRSQPDSPAQ
1099|gene|hut      ----------------ASQPAEPAANTTDTPDEQAVESP-------ENVSTGKGGQPGAS
2366|chp|nrc1      ----------------RSPPADPQ-------ATPHSSPP---------------TTPDTS
2246|gene|hla      ----------------DSDESPPQ------KERDASESP-----------AADQSAPASA
                                       . .               .                     

338|hp|nph         PARSEPSEPSTPDAHESTGRRKAPRDRRP-----------TGSG-----FDSTEATLADE
2290|hp|hbo        PQRTPQSDSEMQTDSTET-RRAATTSSSG----VSDASSASGAS-----AQTARESLLEA
3458|hp|hwa        DDRTSTQTGVSRHGNNDT-TAVADANSTAHTNTSEQRPAENGPT-----RQAAIESLHEA
12705|hp|hma       TARTGVSSEPSGQTSNDQ-PRGTPSQNPP-VSARQPTPSEGGTGDVAANLDAASALLAET
3100|hp|hhi        NARTGAPNPADRTTESER-QPGNSSQDPP-ASARQPAPSEGGAGDVAANLDAASALLAET
1099|gene|hut      GQTASPPSSAQPGQRVDV-PGLEPGEQRP--------PSHGAGD-----LQDARDSLVAT
2366|chp|nrc1      SSTAAATDDVPTAAARDR-PEHAPTAEPT---------------------TPATEELEST
2246|gene|hla      SQNSATSNAVSPQPTTEK-SRDDPTTTPP-------AESAGSET-----VADARASLTRT
                      :            .                                   :   *   

338|hp|nph         IAALTQQAAETSDIGRKRDLLAAAREAAETLQTIRRL-
2290|hp|hbo        ITQHSRRATEIDEPRRAKQHLEAAREAAEALDALDR--
3458|hp|hwa        LTRHAQLAAASDDPRRARDHLRASNEAAEALEQLR---
12705|hp|hma       VHRFAERAAATENPREAREHLQAAREAAEALDAARF--
3100|hp|hhi        VHRFAERAAATENPREAREHLQAAREAAEALDATRF--
1099|gene|hut      LSSFARQAEATDDPRRAQDALEAAHEAAEALAALENVR
2366|chp|nrc1      IAALARRASDADDPRTAREYLEAAHEAAAALDTLRP--
2246|gene|hla      LARFARAAEETDDPRRARDHLQAAREAAEALAALD---
                   :   :  *   .:    .: * *:.*** :*