HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0264COG1107arCOG00429Archaea-specific RecJ-like exonuclease contains DnaJ-type Zn finger domainArchaea specific RecJ like exonuclease.contains dnaJ type Zn finger

HOG Organism Gene ID Name Annotation
cHOG0264 nrc1 VNG1511 arj2 Archaea specific RecJ like exonuclease.contains dnaJ type Zn finger
cHOG0264 hmu HMUK2195 Hmuk_2195 nucleic acid binding OB-fold tRNA/helicase-type
cHOG0264 hma RRNAC0979 putative nuclease
cHOG0264 hwa HQ1797A RecJ-like exonuclease
cHOG0264 hla HLAC1616 Hlac_1616 nucleic acid binding OB-fold tRNA/helicase-type
cHOG0264 hbo HBOR14030 Hbor_14030 RecJ-like exonuclease with DnaJ-type Zn-finger domain
cHOG0264 hut HUTA2931 Huta_2931 nucleic acid binding OB-fold tRNA/helicase-type
cHOG0264 hvo HVO_2889 HVO_2889 putative nuclease
cHOG0264 nph NP2874A hypothetical protein
cHOG0264 hhi 1606 HAH_1606 putative nuclease/nucleic acid binding OB-fold tRNA/helicase-type
cHOG0264 hhi 4411 HAH_4411 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4411|hp|hhi         ------------------------------------MPYEL-------------------
1511|chp|nrc1       MQMATCIVCGSSTD--GHICA--THEEDVVFDFRGDSPDQLTPGRFYRGTVDGFAEFGVF
2931|gene|hut       --MGSCIICGTSVE--GHICD--IHEEDAVFEFRGSTPDELTPGRYYRGTVDGFAEFGVF
10979|gene|hma      --MGSCIICGKSVE--GRICD--LHEEDALFEFRGSRADQLSVDRYYRGSVDGFAEFGVF
1606|gene|hhi       --MGSCIICGKSVE--GRICD--LHEEDALFEFRGSRADQLSVDRYYRGSVDGFAEFGVF
2874|hp|nph         --MGNCIICGTSTD--GLVCD--VHQEDVLFEFTGNEPSQLTPGRFYKGTVDGYAEFGVF
1616|gene|hla       --MGSCIICGVDIDGGGRICD--PHQEDVVFDFRGDSPKQLVPNRFYRGVVDGYAEFGVF
1797|gene|hwa       -------------------MDWITHDEDVWFDFRGDSPQQLTAGRYYRGTVDGFADFGVF
2889|gene|hvo       -------------------MDWITHEEDVWFEFRGNSPHQLVPGRFYRGTVDGYADFGVF
14030|gene|hbo      -------------------MDWITHDEDVWFEFRGDSPHQLTPGRYYKGEVDGFAEFGVF
                                                         . :*                   

4411|hp|hhi         ------------------------------------------------------------
1511|chp|nrc1       VDVGGTVTGLLHRSEVPGRVDSLAWDVGDDVFVQVTDVHDNGNIDLGWSIRESMRDFRGE
2931|gene|hut       VDIGDSVTGLLHESELDSRLESLSWQPGDTVYVRVTNVRDNGNVDLSWSIRQADDEFRGV
10979|gene|hma      VDIGDSVTGLLHRSELDQRLDSLDWDSGDTVYVQVKNVRDNGNVDLGWSIRQSEREFRGV
1606|gene|hhi       VDIGDSVTGLLHRSELDQRLDSLDWDSGDTVYVQVKNVRDNGNVDLGWSIRQSEREFRGV
2874|hp|nph         INIG-NVTGLLHRSKLDQRIESLDWDEGDEVSVQVNNVRDNGDIDLDSSIRQTADEFRGM
1616|gene|hla       IDLSPGVTGLLHRSELDRRLDSLGWEPGDEVFVQVKGVRDNGNIDLAWSIRQADREFRGV
1797|gene|hwa       IDLASGVTGLLHRSELDRRLETLDWESDDTVFVQVKNVRDNGNIDLGWSIRQSQSEFRGS
2889|gene|hvo       VDLASNVTGLLHRSELDRRLESLDWEPGDEVFVQVKNVRDNGNIDLGWSIRQSDSEFRGA
14030|gene|hbo      VDLASGVTGLLHRSELDRRLESLDWEAGDTVFVQVKNIRDNGNIDLGWSIRQSEREFRGS
                                                                                

4411|hp|hhi         ------------------------------------------------------------
1511|chp|nrc1       LVHDPANDSDAALPADDEA-----------------------------------------
2931|gene|hut       LIDDPDEDHELLPEETDEP---------------------------IDEQSTPDESPEST
10979|gene|hma      LVDDPEIGHSVLLENEDDE----------------------------VDEEAAPESTADE
1606|gene|hhi       LVDDPEIGHSVLLENEDDE----------------------DETQSDDSDEEASRPSTDE
2874|hp|nph         LVQTPDGEH--LPDAADDD-------------------------------EADADEQTGG
1616|gene|hla       LVQD--GDTEHLPEEGGEE-----------------------------SDAEADAEPDEL
1797|gene|hwa       EIHDPTGANDGEPVGSETDDNTDAELTTEATATPSVSRGGSDADAATVKRTPAATSTEDT
2889|gene|hvo       RIHDPDGDADGQPVEQDAE-------------------SGGPTTVKTRPKTGKTTKPAGV
14030|gene|hbo      RIHDPNGEDDGKPVEESDD----------------------------SSSAPVKKKPKDV
                                                                                

4411|hp|hhi         -------------------------------------------------------DSTGT
1511|chp|nrc1       DSDTTDDGDTTD----------------------------------DSRDAETADGGKRV
2931|gene|hut       ESESTDSKQTDA------------TTTGAVRTREDSQTGGGAVGLEESESASAADESASA
10979|gene|hma      STSQSDDESSAD----------DDSGASQPDSESSTSAGAVSRASDDDRVEGTASVGGND
1606|gene|hhi       SAGQSDDESDAD-------------EGTESDDSSATNAGAVSRASDDDRVEGTAAVGGND
2874|hp|nph         SPESSDDGPTTQ---------------------------------EPSVDEQTGGNPSDP
1616|gene|hla       DVADDETADASD----------DESADVDEAAEPDEGDGDVSAEADEVAKADEADDEGGA
1797|gene|hwa       STASTDETISADTDQE-TPGESANTEAGITAAETETKTETVSVSAENTSTATNAASTQSP
2889|gene|hvo       STSSEQTESDADAEPEPEPKPESDAGDEDRAPTAGDVVDDIAANGESEQEADAEPESEPE
14030|gene|hbo      STKSRERNGESQ-----------------------------TTNADDGAVAESDADTQDA
                                                                                

4411|hp|hhi         AAEQDGNETETDEG----------------------------------GGLESSLGMTI-
1511|chp|nrc1       SDADATTERAADASF----------------EFSGADDDDTDHETVRVDALDDHVDDAVT
2931|gene|hut       GSADVEGTADEDVE-----------------DEPAEAERTPEPPSVDVGDLEGWIGDTVR
10979|gene|hma      SGSNTAVMTESDEEADAES------------EASQSDETTDEPVAAAIGDLDDHVGADVR
1606|gene|hhi       SGSNTAVMTESDEEADAESDES---------EEQTDEATTAEPVAAAIGDLDDHVGADVR
2874|hp|nph         ELAEMATESDEDDEAAAEAEE----------AEAGDVDAESDIDRVAVETLRDRVGDVVR
1616|gene|hla       DETDEGDESDADEGENESGAD----------ESAEDDDLDDERERVEIGTLTDAVGDAAR
1797|gene|hwa       SSTTQGIDVDDDDDDELSNQSPPVSDSPQKTESEALNELADDREPVSIDSLSDRVGSDVQ
2889|gene|hvo       SDSESKEDAESDDEQEV--------------ETDADAESADEAERVTLASIDDRVGDVIR
14030|gene|hbo      AAETESAEAETAEAET---------------PTHEAEAETDRFELVSIENLSDRVGDAVR
                                                                      : . :.    

4411|hp|hhi         ---------------------------------------PEDHVGAFV------------
1511|chp|nrc1       VEGEITAARQTSGPTVFELTDETGAVDAAAFVEAGVRAYPEIEPGAVVQLTGTVERRRGD
2931|gene|hut       ITGEIVDARQTSGPTVFELRDGTGSVDCAAFVEAGVRAYPSVEEGAVVEIDGEVRERRGE
10979|gene|hma      LEGEVVGIRQTSGPTVFELQDETGTVDCAAFVEAGVRAYPEVEEDDYIRLSGDVRERRGE
1606|gene|hhi       LEGEVVGIRQTSGPTVFELQDETGTVDCAAFVEAGVRAYPEVEEDDYVRLSGEVRERRGE
2874|hp|nph         LEGVVASVRQTSGPTVFELRDETGIVDCAAFVEAGVRAYPEIETDDVVRLDGEVRLRRDE
1616|gene|hla       IDGEVVSVRQTGGPTVFEVLDETGVVDVAAFVEPGVRAYPDIEIGDAVRIDGEVESHRGD
1797|gene|hwa       IEGEIVEARQTGGPTVFELRDESGTVECAAFVEAGVRAYPDVGDGDIVRLNGEVERRRGE
2889|gene|hvo       VEGEIASVRQTGGPTVFELRDETAIADCAAFVEAGVRAYPEVEVGDYVRIDGEVERRRGE
14030|gene|hbo      IEGEVVSTRQTGGPTIFEIRDETGVVDCAAFVEAGVRAYPEVGESDIVRLDGEVEVRRDE
                                                           *.   .  :            

4411|hp|hhi         -------AEALEDPERATTWTDIVDTMVAPVARDAWAELS----PIEQATEVLSKAAEFD
1511|chp|nrc1       LQVETEAVTELTGDRADEVRNRMDAALDDRAAPATTALLAPDDDAVAAVHDDIVDAATAV
2931|gene|hut       LQVETEELELFDEDKREAVLEEIEATLSERARPDEIDPLV-ADEAVAAESESIRDVVGEI
10979|gene|hma      LQVETEDLDVLEAEEREEVEQRLADALDDEARPDTADPLA-EDTAVAALSDELVEAATQI
1606|gene|hhi       LQVETEELDVLEAEEREEVEQRLADALDDEARPDTAEPLA-DDTAVAALSDDLVEAATQI
2874|hp|nph         IQVETDSLVALEDDAREDVESRMDAAIENRARPESVEPLA-DDDAVSAITDDIADAATEI
1616|gene|hla       VQVESEALVLLEGEEAETVRRRLAEALTAEARPEGLQPLA-GDETVAELADGLLDAAEAI
1797|gene|hwa       IQVETNELTPLEGAAAETVENRLVDALTAEARPETATVLA-TDDPLSALSSQFVDAATAI
2889|gene|hvo       LQIETEELTILDGDEADTVAQRLADALSDEARPDAVAPLA-AHEPVAAVGKSLLDAAEAI
14030|gene|hbo      LQVETEELVALEGEEADAVVQRLDDAMAARARPDSVEPLA-AHAPVEAVTEQLRDAAETV
                              :       .   :  ::   .       *     .:    . : ...   

4411|hp|hhi         RRAIE------------------------------------------HFEAVPLDG---D
1511|chp|nrc1       RRAVIDARPVIVRHPTTVEGYVAGTAIERALLPLIRDEHAREDAEYHYVDRRPLDDAFYT
2931|gene|hut       RRAVLEDRPVIVRHSATTDGYVGGAAIERAVLPLVRDRHDRRDAEYHYIDRRPIEGDVYG
10979|gene|hma      RKAVLTDRPVIVRHANTADGYLAGSALERAALPLVTEQHRRADAKYHYFDRRPIEGGVYD
1606|gene|hhi       RKAVLTDRPVIVRHANTADGYLAGSALERAALPLVTEQHRRADAKYHYFDRRPIEGGVYD
2874|hp|nph         RRAVLESRPVVVRHDATTDGYVAGAAIERAVLPLIRDEYESADAVYHYFDRRPLEDGVYD
1616|gene|hla       RRAVLESRPIVVRHPATADGYVAGAAVERAVLPLIREEHAKSDAEYHYFTRRPLDDPVYG
1797|gene|hwa       RRAVLESRPIVVRHAATADGYVAGAAIERAVLPLVKEEHARADAEYHFFTRRPLDDPVYG
2889|gene|hvo       RRAVLESRPIVVRHTATADGYVAGAAVERAVLPLIREEHPRDDAEYHYFTRRPLEEAVYG
14030|gene|hbo      RRAILESRPIVVRHPATADGYVAGAAVERAVLPRIREEHERADAEYHYFTRRPLDDPIYG
                    *.*:                                           ..   *::     

4411|hp|hhi         RSEAETDIDEGLRCRRNAD---------------TFRDGVAAA--YG------DGRLDDD
1511|chp|nrc1       IDDATGDVTSMLEAAHRHDEKHPLFVFVGTGSTTESTDALDLLDIYDADTVVVDGGYADD
2931|gene|hut       LDDATTDVTRMLGDRERHDENLPLLVFVAAGGTEESLDGFELLDVYDASKVVIDTV-AES
10979|gene|hma      MDDATKDTTTMLDNRERHEEKLPLFVFVAAGGTRESLDGFDLLNVYGAPSVVIDDIDVDG
1606|gene|hhi       MDDATKDTTTMLDNRERHEEKLPLFVFVAAGGTRESLDGFDLLNVYGAPSVVIDDIDVDG
2874|hp|nph         MDDATKDVTRMLDDRERHDEKLPLFVFAAAGSTAASTDGLELLDVYDAPRVVLDGRPVDD
1616|gene|hla       MDAATNDATRMLQDRDRHDEQLPLFLLVGTGSTTESADGIDLLSVYGVNAVVVDAEVADP
1797|gene|hwa       MDTATNDVTQMLQDNERHDEKLPLVVLVGVGGTVDSLDGIELLGVYDAPRVVIDAGDLDE
2889|gene|hvo       MDAATNDVTRMLEDRDRHDEKLPLVLLLGAGSTAESLDGLGLLGVYGSERVVVDAAPADD
14030|gene|hbo      MDAATNDVTRMLQDNQRHDEKLPLVLLLGVGATAESLDGLGLLDVYGAERVVVDAAAADE
                     . *  *    *    . :                  *..     *.      *    : 

4411|hp|hhi         GLVDALEAAE--------------------------------------------------
1511|chp|nrc1       A--AGMDVLVSPTAAGEQPV-----NTG----ALGAQLAAVINDDVREDLAHLPAVAYWT
2931|gene|hut       TIVDTVDAALAPKADATSVAIADGTTRGPTASALAATVGAHVEEDVRPDLAHLPAVSYWG
10979|gene|hma      AVVDTVDAVVSPSADAVSET-----TST----ALAANVAAHVNEDVRDDLQHLPAVSFWE
1606|gene|hhi       AVVDTVDAVVSPSADTVSET-----TST----ALAANVAAHVNEDVRDDLQHLPAVSFWE
2874|hp|nph         AVDDEIDAPV--TADGRTSA------------TVAAAVAAAVNGDVRADLEHLPAVSYWD
1616|gene|hla       ETREAVDTLVSPEIDGVDADL----STG----ALVASLASAVNDEVRTDLRHLPAVSYWA
1797|gene|hwa       AILTEVDTVVSPLTESNDSLTAVPISTG----AVGANLAATINSEITAELEHLPAVSYWD
2889|gene|hvo       EVAAEVDVLVNPAREGADARDL---SVG----ALASTLSVAVNDDVRDDVSHLPAVSYWE
14030|gene|hbo      EVEDVADAVVNPGLAGTDAADL---STG----ALGANLAAAVDSGVREDIAHLPAVSYWE
                          :.                                                    

4411|hp|hhi         ----------------FDTEIIA-----------------RRE-----------------
1511|chp|nrc1       DL--PAAYADLAADASYDSDAREALRDAVALEAFYQSYEDKRELIADLLWG---------
2931|gene|hut       EV--PEAYAAAAAEAGYDGTAVSEIREAVALEAYYQSYEDKRELVTDLLFG-------GR
10979|gene|hma      DI--PEPYIDAASGAGYDETAVSELREAVALEAHYQSYEDKRELITDLVFG---------
1606|gene|hhi       DI--PEPYVEAASEAGYDETAVSELREAVALEAHYQSYEDKRELITDLVFG---------
2874|hp|nph         ET--PTVYTDLATGAGFDEETVEQLREAIALEAFYQSYEDKRQLIIDLLFG---------
1616|gene|hla       ET--PDRYVELARDAGYDAERVAELREAVALEAYYQSYQDKRELVADLLFE---------
1797|gene|hwa       QTQAPSVYVDRAAAAGYDATQTRELREAIALEAYYQSYQDKRELITDLLFE---------
2889|gene|hvo       NC--PQQYLDLAESHGFDVDRVRELREAVALEAYYQSYQDKRELIADLLFD---------
14030|gene|hbo      DT--PAEYVELAEEAGYDADRTRELREAIALEAYYQSYEDKRELITDLLFDDGVSPGAQR
                                    :*                      .*:                 

4411|hp|hhi         --------DLIERIDSVF-------------EIDYRPYGGT-------------------
1511|chp|nrc1       ----DADDDLADHIATQFRDRLATELSTAEPHLSTRHHDGVAFETLDVGAYTHQYDFPPV
2931|gene|hut       ETTDADVRGLASHVSEQFREKLDVAVETAQENLDRRSVGDETIGVLDIDRFTHTYDFPPA
10979|gene|hma      -DDEEDVGGLAGHIAEQFREKVDEEVSTARANLDHRTVDGVDIAVLDTDAFTHQYEFPPE
1606|gene|hhi       -DDEEDVGGLAGHIAEQFREKVDEEVSTARANLDHRTVGDVDIAVLDTDAFTHQYEFPPE
2874|hp|nph         -----EQTGLAAQVSEQFDTKLEAELETATTNLDERTVDGYDVTVLDTDAYTHTYDFPPT
1616|gene|hla       -----DSGNLAAHVSEQFREKLETEIKTATENVVTEAVDGVEFAVLDTDGYTHRYDFPPT
1797|gene|hwa       -----DDGGLAGHVSEQFRLKLDAEVETAEANLETYRADNVEVVKLDADAYSHRFDFPPT
2889|gene|hvo       -----ADEGLAGHVSEQFRIKLEDEIETAQANLERREVGAISAAVLDSDAYSHRFDFPPT
14030|gene|hbo      AGGDAVEGNLAAHIAEQFRIKLDAEVETAQANIDVREEAGVTVAVLDADAYTHRFDFPPT
                            .*  .:   *              :                           

4411|hp|hhi         --LMDD-------DDG-----------------------------PEPETEHGETW----
1511|chp|nrc1       DLLLDALHRRA--DSTDVLLGAGEDALRVRSDDAVDVHAVVDAIDDDLTTTAGVTARGAR
2931|gene|hut       TLLLDELYRRS--DDLTAIVGVDEDELHVRSGHELDVRELVDAA-DETVEGADLEPLSTR
10979|gene|hma      SLLLDELHRDVR-DESDAVLGISTDTMYVRANGDLDLHELVNEV-SERVPEGGVATRSVR
1606|gene|hhi       SLLLDELHRDVR-DESDAVLGISTDTMYVRANGDLDLHELVSEV-SERVPEGGVATRSVR
2874|hp|nph         RLLLDELSRRL---DADAVVGVATDELHLRAADDIDISAVADTV-AEAVPNAGVSDPGAR
1616|gene|hla       PLLLDDLHRRNANGEAYATVGIGMDELYLRTTADVSVRDVAERT-AELAPGADVTTAGLR
1797|gene|hwa       ALLSETLHRQTR-SESSVTVVYSTDELFVHATTDLDIRAVASAA-GNTVPEGGVTAVGVR
2889|gene|hvo       GLLVDELHRRTREGDAFVTVALGMDELYLRATGDLDLRAVVESA-AEKAPAAGLAAAGIR
14030|gene|hbo      SLLVDELHRRNREGDEYVTVATSTDELFVRTTDDVDIRAIAEAA-RDAVPEGGVTAVAVR
                      * :         .                               :     .       

4411|hp|hhi         -------------------------------
1511|chp|nrc1       DGRIEFLAGERDAVLDAVVDAIAAQLA----
2931|gene|hut       SHRIEFLAGQRSTVVDAVLDAIVDSV-----
10979|gene|hma      EGTIRYLAGERPAVLDATLDVLADEL-----
1606|gene|hhi       EGTIRYLAGERPAVLDATLDVLADEL-----
2874|hp|nph         EPKLEFLAGKRDAVIDAVVDAVAEQVTAPSA
1616|gene|hla       EGKIEFLSGERDAVEDAIVAAVAEAF-----
1797|gene|hwa       QNRVEFLAGARESVVDAVVDAAVAQINN---
2889|gene|hvo       EGRIEFLTGARDEALEAVLDAAAEQF-----
14030|gene|hbo      DNRIEFLSGARDEVVDAVVTATVDQF-----