HOG Organism Gene ID Name Annotation
aHOG2631 hbo HBOR13940 Hbor_13940 hypothetical protein
aHOG2631 hla HLAC1982 Hlac_1982 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


13940|hp|hbo      MINESLNYLRNDEDWVKTVLIGGILSLLSVLIVPTILVAGYLVRVIRRTMHGIEEPPEFD
1982|hp|hla       MISESLNYLRDGDDAIVTVAIGGVLLLASPLLIPSFLVLGYLMRVIRQTADGDDEPPVFE
                  **.*******:.:* : ** ***:* * * *::*::** ***:****.*  * :*** *:

13940|hp|hbo      DWGDMAVDGLKAMVIAFIYGFIPSLIAGVLVGGSIFAIVAGNAARSGGL--SIAGGAGVL
1982|hp|hla       AWSDLLVEGLKAFVVTFVYSLLPLAILAVAAVFGIGAVVVGSGDGTGGVLGGLIGGLLAL
                   *.*: *:****:*::*:*.::*  * .* .  .* *:*.*..  :**:  .: **  .*

13940|hp|hbo      LGLLVSFVLGLVAAYIIPAAIANFAETDQFGKAFSVGDLRSVLVSGKYFTAWVSGFAVIF
1982|hp|hla       LLVVVALAVSLAGVYVTPAALAAVADSGRVGDGFAVGTLWGVVTKRAYAVGWLTAVAVVF
                  * ::*::.:.*...*: ***:* .*::...*..*:** *..*:..  * ..*::..**:*

13940|hp|hbo      VAGLVASILNAIPALGFIAGGFLGFYAAVAAYYIIGNAWGELHDVEMQEGEGQPDEQAAV
1982|hp|hla       AGSLAIGVFSIVPILGTIAGVFVQFYAIVAAAAIIGWTWTDVRPVATDVAEPDPVNRPAV
                  ...*. .::. :* ** *** *: *** ***  ***.:* ::. *  : .* :* :..**