HOG Organism Gene ID Name Annotation
aHOG2630 hbo HBOR37860 Hbor_37860 hypothetical protein
aHOG2630 hla HLAC1056 Hlac_1056 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


37860|hp|hbo      MSSESAPSRKDFGRPALRRLEEEHDDLVAELRAGFDSLDEVIFWCQRLSMRTLGCLDDGL
1056|hp|hla       ---------------------MSQNDVPESLEAAAE------------SDRPRGILTPSD
                                        .::*:  .* *. :            * *. * *  . 

37860|hp|hbo      YQQFGNERVLWSTLITSPERERYGHDTVSLEAAEEFRLLVEATYVLPATRSAFRKLRGSA
1056|hp|hla       RDFLLGRKTDYTDHSRKQKRNRIRRRVRN--AILDFSILFEC--LEERDRKTVFDPNDED
                   : : . .. ::    . :*:*  . . .  *  :* :*.*.  :    *.:. . ... 

37860|hp|hbo      GEYFGDDKDDTVTVADEQFIAMRPALDHLEERQKETLSQLLDGIEGGKPELLDWLRDLNG
1056|hp|hla       REAYTQGITDMLAFLHLGTMGYHTPFKDM----------LSEGV--GKAE-----QQLAG
                   * : :.  * ::.     :. ...:. :          * :*:  **.*     .:* *

37860|hp|hbo      ATFGQIDSEFQVRAFKESRVTQEVL------LDEFEDPSAARKTRQLFAFEFLLPAFNAG
1056|hp|hla       SNYRMVNVEFNVEPVGQIDVDEVVAKLENGEFAELTDEELRAFVRLLTMSESFSPE-DAG
                  :.:  :: **:* .. :  * : *       : *: * .    .* *   * : *  :**

37860|hp|hbo      --VRKLVGKAGEDTVEEEEDDQSAGDHIDV
1056|hp|hla       EEIKDRVDEFAEKLTESATSHERTLEELTN
                    :.. *.: .*. .*.  . : : : :