HOG Organism Gene ID Name Annotation
aHOG2618 hbo HBOR22590 Hbor_22590 ABC-type dipeptide/oligopeptide/nickel transport system, permease component
aHOG2618 hbo HBOR30080 Hbor_30080 ABC-type dipeptide/oligopeptide/nickel transport system, permease component
aHOG2618 hla HLAC0675 Hlac_675 binding-protein-dependent transport systems inner membrane component
aHOG2618 nrc1 VNG2359 appB oligopeptide ABC permease
MUSCLE (3.6) multiple sequence alignment


675|gene|hla        MGFGRYVTARVLWAGVVSLIITTITFFLVSAAPNPAVQEAATQAALQGGDPAAAAERARE
22590|gene|hbo      MKW--YITRRLAWTVVATLIILSLTFGLMAASPDPQAASYVAQQVQEGGNYQEAQESYEK
30080|gene|hbo      MKW--YIAKRLAFTLFATWIALTVTFGLITASPNQAQMKSMMSCAATGDNPEECKERFRE
2359|gene|nrc1      MKW--YIVKRVLWTFVVMWIALTLTFGLLVASPDTGQTKSVMSCSASGGDAQQCREQYRE
                    * :  *:. *: :: ..  *  ::** *: *:*:    .   .    *.:   . *   :

675|gene|hla        LRGLDQPLYVRYMDFIEGVYTLDWGWSRSRSQPVTQALGEGLYYTAQYSVPWTILTVLIG
22590|gene|hbo      ARGLDKPLWERYKNYMVGMVTLDWGWSETRSQPVIQAISEAWPYSVMYGTPALIISTVVG
30080|gene|hbo      QHNLDQSATERYKNYMINMATLNWGWSDSRSQYVIPALLDAWKYTAQYAIPVLVISTVIG
2359|gene|nrc1      RQNLDKPITERYVNYVTNMATLNWGWSESRSQSVMAAISEAWPYTAQYAIPVLVVSTILG
                     ..**:.   ** ::: .: **:**** :*** *  *: :.  *:. *. *  :::.::*

675|gene|hla        PVVGVYSAANMYSWKDHAATGFAFFGYAIPNFFFGIILLLIFGVWLEVIPIVYNTDVS--
22590|gene|hbo      VAIGLYSATHRNSLEDYAASAFAFFGISIPDFWFAILMILIFGVWLGWIPIYYHSDVP--
30080|gene|hbo      YALGLYSAYKPYTLSDYAGSFVAFFGISIPNFWFAIILIMLLGVRFESLPVYYQSGIPQQ
2359|gene|nrc1      YGLGLYSAYKPYTKADYLGSFVGFFGISIPNFWFALVLIILLGTHFEFISTYYQSGIPIN
                      :*:*** :  :  *: .: ..*** :**:*:*.:::::::*..:  :.  *::.:.  

675|gene|hla        --VFSVQNAVQLSVPVFVLVTGSIGAVMRVSRNESAEFQNAEFMKTAKAKGVSPLRAYAY
22590|gene|hbo      --WLSLQNAQQLVAPTLVVTLSSIASEMRFSRATALEYVNAEFVKTAKAKGANSWRRVTR
30080|gene|hbo      QGWFSIANIKQLLLPITVLLTASFAFQTRYSRAQALEQMNQEFVKVAKAKGASHYRLMVW
2359|gene|nrc1      QGWASMANITQLLIPSFVLLTASLAWQMRYSRAQAIEQMNQEFVKVAKAKGASQWRLMIH
                        *: *  **  *  *:  .*:.   * **  : *  * **:*.*****..  *    

675|gene|hla        HVMRPTLVPLSTTLVGQLLALFLGSSLLVEVVFGIPGIGRVTYNALIAQDTNLLLGSTLA
22590|gene|hbo      HIFRPALVPLSTILVGDILNIVLVSSYLVEVVFGIPGLGQLSYKAILQQDVSLVLGTVLI
30080|gene|hbo      HVLRMAAVPLSTSFVGRMLGIFFAGSVVIEQIFSIPGLGFMTYTAIVEQDTTLVLATTLI
2359|gene|nrc1      HVFRMAAVPLTTSFVSSLLAIFWSGSVIIEQIFSIPGLGLMTFTAITEQDTTLVLATTMI
                    *::* : ***:* :*. :* :.  .* ::* :*.***:* :::.*:  **..*:*.:.: 

675|gene|hla        FTFIAVIGNLLEDLVFTVLDPRISFDDR
22590|gene|hbo      PTFIAIIGNLFQDLAYTVLDPRIDYGDR
30080|gene|hbo      TVFLAIIGNLLEDIAYVLLDPRIDYGGR
2359|gene|nrc1      TVFLAIIGNLIEDVSYTILDPRIDYGDR
                     .*:*:****::*: :.:*****.:..*