HOG Organism Gene ID Name Annotation
aHOG2617 hbo HBOR22620 Hbor_22620 ABC-type oligopeptide transport system, ATPase component
aHOG2617 hbo HBOR30050 Hbor_30050 ATPase component of various ABC-type transport systems with duplicated ATPase domain
aHOG2617 hla HLAC0678 Hlac_678 oligopeptide/dipeptide ABC transporter, ATPase subunit
aHOG2617 nrc1 VNG2365 appF oligopeptide ABC transporter ATP-binding
MUSCLE (3.6) multiple sequence alignment


678|gene|hla        ------------MTDEPILSVRDLKKHYPLRKGIFNRQVGAAKAVDGISFDIASGETLGL
22620|gene|hbo      -----------MSSDAPLLEVRNLKKHYPITKGIMKREVGSVRAVDGISFAVERGETVGL
30050|gene|hbo      MSFQSSDSSQREKAEETLVEVSGLKKHYPIKEGILKREVGRVKAVDGISFEIERGETVGL
2365|gene|nrc1      --MSKQIVNTESDAAESLMRVDGLKKHYPITEGVLRTEVGRVRAVDGVSFEVRAGETLGI
                                 :  .:: * .******: :*::. :** ..****:** :  ***:*:

678|gene|hla        VGESGCGKSTAASSVIRLEEPTAGEVVFNGNGRGGATRNPDGTHPNDVTKFSDAELKRFR
22620|gene|hbo      VGESGCGKSTAATSLLRLEDPTDGEVLFEG---------------RDITEYNDKELKRFR
30050|gene|hbo      VGESGCGKSTAAEAILRLEEPTDGTITFDD---------------EDITEYDDTELKSFR
2365|gene|nrc1      VGESGCGKSTVAESVLRLTDPTAGSVYFDG---------------EDVTAYDDTALKRFR
                    **********.* :::** :** * : *:.                *:* :.*  ** **

678|gene|hla        RGAQMIFQDPASSFDPRMTVGSAVAEMLEIHGMSDRHRRRAIVEDLLERVGLSAVDYDRY
22620|gene|hbo      REAQMIFQDPTSSFDPRMSIGESVAEPLTVHGMRDRERRRRIVKDLLERVGLSADDIDRY
30050|gene|hbo      REAQMIFQNPDSSFDPRMSIGESITEPLRIHGVGPREHRLAIASDLLERVGLNASDVDRY
2365|gene|nrc1      REAQMIFQNPDSSFDPRMTTGESVAEPLKIHGVGPRSRRLEIARDLLERVGMSGEDAARY
                    * ******:* *******: *.:::* * :**:  * .*  *. *******:.. *  **

678|gene|hla        PHEFSGGQKQRIALARALVLNPDLIIADEPVSALDVSIQAEILSLIDDLQAEFDLSMLFI
22620|gene|hbo      PHEFSGGQKQRIGLARALVLNPKLIVADEPVSALDVSIQAEILSLMKEIQDEFGLGMLLI
30050|gene|hbo      PHELSGGQKQRVALARALVVNPRLIVADEPVSALDVSVQAEVLTLLKDIQTEFDLSILFI
2365|gene|nrc1      PHELSGGQKQRVALARALVVNPRLIVADEPVSALDVSVQAEVLTLLNDIQAEFNLGVLFI
                    ***:*******:.******:** **:***********:***:*:*:.::* **.*.:*:*

678|gene|hla        SHDMSVIRRICDRVAVMYLGEIVEVGPTDEIFADPQHPYTEALLSSIPTPDPRSSVGGIE
22620|gene|hbo      SHDLSVVREICDRVAVMYLGEIVEFGRTEDLYEDPQHPYTRALLSSIPQPDPTKRGNAVE
30050|gene|hbo      SHDMSVVREICDTVAVMYLGQIVEIADTETLFEDPQHPYTRALLRAIPTIDAGTRGIDAA
2365|gene|nrc1      SHDMGVVREVCDRVAVMYLGEIVEMGRTEDVFNDPEHPYTRALLRSIPTVGVESRGTDAG
                    ***:.*:* :** *******:***.. *: :: **:**** *** :**  .  .      

678|gene|hla        LTGTVPSPTNPPSGCRFHTRCHRVIQPEGIDIDQSDWRGILNFRDRVAAGQVDVESIREN
22620|gene|hbo      LTGDVPSPSNPPSGCRFHTRCPEVIPPEGYDFEQEAWRSVMDLRVRLRRGGVDADAVREF
30050|gene|hbo      LSGDVPNPSDPPTGCNFYTRCPEVVQPEGYDFEQENWRAVMDLRVALERHGIDVEGLREF
2365|gene|nrc1      LRGEVPPPSDPPTGCNFHTRCPEVIQPDGYDFEQAHWRGVMNLRVAVERHGVDVAGLRAF
                    * * ** *::**:**.*:***  *: *:* *::*  **.::::*  :    :*. .:*  

678|gene|hla        IVVEGG----AASDNDVREQLRKEFDIGERLDDPEIEDTLREVIDRLLARDDEEAAELLS
22620|gene|hbo      VASETSQSPEAVSEDRIKAEIRREFDIPEQLADASAESVLSDALELLANGDQSEARDLLG
30050|gene|hbo      VGLDAGDSITPQDVEKMKAELRREHDIPPSLTDSAAESVLEEALDEIVRGNGASAEALLA
2365|gene|nrc1      VGVEDDASVSPADADAMKAELRREHDIPETLTDPSAEATLEAALDDIVRGDVEDGRAVLA
                    :  : .    . . : :. ::*.*.**   * *.  * .*  .:: :   :  ..  :*.

678|gene|hla        DRFSTPCAETTPERTVHAEGHESACLR-HESEHVVAASPIDG
22620|gene|hbo      DEFETVCETATPELRRTPVGHSASCHLIETSEDTLTAPSTND
30050|gene|hbo      REFETVCGQSEPSLAESAAGHPTSCHL-HSREVTQTPPLTDD
2365|gene|nrc1      EEFETVCEGESPPLDEDGTGRPTACHR-----DGAAARGGDD
                      *.* *    *       *. ::*          :.   :.