HOG Organism Gene ID Name Annotation
aHOG2615 hbo HBOR22600 Hbor_22600 ABC-type dipeptide/oligopeptide/nickel transport system, permease component
aHOG2615 hbo HBOR30070 Hbor_30070 ABC-type dipeptide/oligopeptide/nickel transport system, permease component
aHOG2615 hla HLAC0676 Hlac_676 binding-protein-dependent transport systems inner membrane component
aHOG2615 nrc1 VNG2361 appC oligopeptide transport permease protein
MUSCLE (3.6) multiple sequence alignment


676|gene|hla        MATQKPE--RFDQVDWNNISRSRWFDLSINSIGMLATAVPLLLVALSDWQILDERTPTLE
22600|gene|hbo      MAAEDYQD-RFEDIDWDDLQRSGFDSLTVQSGGYLVSMGILAVLLAYDYFL--AQGPTIT
30070|gene|hbo      MATENNDI-SFEDIDWDAQSTSTF-SLSKQGIAEAGCYLLIVALFAYDYAVIENAHPLI-
2361|gene|nrc1      MAAEDADTATFEDIDWDAQGISTL-GVSRAGLAELLSYLGLIVAFVYDYTW--NTGPLV-
                    **::. :   *:::**:    *   .::  . .       :      *:       * : 

676|gene|hla        PIGLEWDIGTVDYLFIFTLLLFAFYIVLPLFQNPRRTKYYWREFKRNRPAVVSLGWLAIV
22600|gene|hbo      -TPFQWDVSQLDWLLIATLVTVAFYAVYPLYDNPRMTRRYWREFSKNRAAVISGVFLTLI
30070|gene|hbo      ---WNWDVLSVEWLFAATFVALLFHIVLPLYKNERMRQFYWRRFKKNRIAVIALVYLAVV
2361|gene|nrc1      ---FRWDVLSVEWLFIGTLIAIVFHAVIPLSQKPRLRAFYWRRFKKNQVAVVALGWLAVM
                         **:  :::*:  *:: . *: * ** .: *    *** *..*. **::  :*:::

676|gene|hla        FVGGIVGPFFISAPEQSILTGYQPPVFLSIDQSYVSTCVGEIATGQCH-GTWQHPLGTTA
22600|gene|hbo      FGLGLVGPMFVSKPELNVLAQYQPPVFFSVPESTVGSCMGPVVDGMCQ-GTWQYPLGTTG
30070|gene|hbo      FVIGILGPLVVDPPQVRFTNRILPPV-----------GVTAVVDGVAKTGTWQYPLGTSA
2361|gene|nrc1      FVVGVLGPLLIDPPTTQFTNQSVPPV-----------GMSTTVGGVVKTGTWQYPLGTSA
                    *  *::**:.:. *   .     ***            :   . *  : ****:****:.

676|gene|hla        GGKDIFAGIVHGMTISMQIGFITTTIVASIGITFGTVSAYAG----GWADELMMRFVDIV
22600|gene|hbo      QGKGIMKSVVYGMRVSLEVGLITPLIIILIGTAVGTIAAYSG----GLMDELLMRYVDIQ
30070|gene|hbo      EGRGILALVVYGMRVSMEVGLVSTIIAVFIGSLVGSVAALATATDIGWMDEVLMRYTDIQ
2361|gene|nrc1      KGQGILTLVVYGMRVSMEVGLIATIFSVIIGSAVGAVAAFATSVGRGRIDELLMRYVDVQ
                     *..*:  :*:** :*:::*:::. :   **  .*:::* :     *  **::**:.*: 

676|gene|hla        LSFPTLLMFLLILYIYGAGLGMFILVFAAFAWGGTARYVRSKSLSISEEEFIKANRISGA
22600|gene|hbo      LTFPTFFLYLLLLYLYGGTLFLLIVIFGLTSWGSTARLVRSEALQRREEEYIQAAQSAGA
30070|gene|hbo      SVFPVFILLLLLVYLFGAELWMIIALYGFFGWEGIARTVRGEALQRSSEAYIKAARASGA
2361|gene|nrc1      SVFPDFMLLLLLTYLFGSELWMIILLFGFFSWEGIARTVRGEALQRASEEYITAAEASGA
                      ** ::: **: *::*. * ::* ::.  .* . ** **.::*.  .* :* *   :**

676|gene|hla        STYRVVRRHVVPNAASSIITQLTLLIPGFLLAEAQLAFLGLGDSTIPSWGQLISAGRSDL
22600|gene|hbo      SEFWVIRKHLVPNVSNTVITNASLLIPSLILFEAAFSFLGLGDPTIPSWGQVIAAGRSDI
30070|gene|hbo      NMLYIVRTHLIPNSANSVIISASVLIPGFILGEATLAFLGFSDPSTFSWGRTISAGQANI
2361|gene|nrc1      NMLYIVRQHLIPNSANSIIISATVGIPGFILGEASLAFLGFSDPTTYSWGRTIATGQVNL
                    .   ::* *::** :.::* . :: **.::* ** ::***:.*.:  ***. *::*. ::

676|gene|hla        SFAPWIVLVPGIVLFLTILAFNFLGDALLDALNPEAEAESA---
22600|gene|hbo      DTAWWISTIPGVFLFTTVLALNFVGDALRDALDPRSED------
30070|gene|hbo      EQAWWISTIPGLFLFFTVLSFYYVGEAMRDAMDPRQEIEGGGGL
2361|gene|nrc1      ASAWWIATIPGVFLFLTVLSFYYVGESLRDAMDPRQEVDGGGGL
                      * **  :**:.** *:*:: ::*::: **::*  *