HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0261COG0538KOG1526arCOG01164Isocitrate dehydrogenasesisocitrate dehydrogenase.NADP

HOG Organism Gene ID Name Annotation
cHOG0261 nrc1 VNG1873 icd isocitrate dehydrogenase.NADP
cHOG0261 hmu HMUK1506 Hmuk_1506 isocitrate dehydrogenase, NADP-dependent( EC:1.1.1.42 )
cHOG0261 hma RRNAC3419 icd isocitrate dehydrogenase
cHOG0261 hwa HQ3212A icd isocitrate dehydrogenase (NADP+)
cHOG0261 hla HLAC2330 Hlac_2330 isocitrate dehydrogenase, NADP-dependent
cHOG0261 hbo HBOR09930 Hbor_09930 isocitrate dehydrogenase (NADP)( EC:1.1.1.42 )
cHOG0261 hut HUTA0281 Huta_0281 isocitrate dehydrogenase, NADP-dependent
cHOG0261 hvo HVO_2588 HVO_2588 icd isocitrate dehydrogenase NADP-dependent
cHOG0261 nph NP2430A icd isocitrate dehydrogenase (NADP+)
cHOG0261 hhi 647 icd isocitrate dehydrogenase
MUSCLE (3.6) multiple sequence alignment


2430|gene|nph       --MGYDKVEVPAEGEKVAVDEDD--ELIVPDDPVIPIIHGDGIGTDVGPAAQKVLQAAAD
2330|gene|hla       --MSYDKVDVPDDGEAITLADEETGELNVPENPIIPIIHGDGIGTDVGPAAQKVLDAAAE
3212|gene|hwa       --MSYEQITAPEAGERITVTNAETGELDIPDTPIIPIIHGDGIGTDVGPAAQQVLEAAAE
9930|gene|hbo       --MSYDQIEVPENGEKITLADEETGELSVPDNPIIPIIHGDGIGTDVGPAAQKVLDAAAE
13419|gene|hma      MGYDYDKVEVPDEGQQIQVTEDD--ELDVPENPIIPIIHGDGIGTDVGPAAQKVLEAAAN
647|gene|hhi        MGYDYDKVEVPDEGQQIQVTEDD--ELDVPENPIIPIIHGDGIGTDVGPAAQKVLEAAAN
1873|gene|nrc1      --MSYDKIEVPEGGAKVSYDEAA-DELDVPDTPIIPIIHGDGIGKDVGPIAQDVLSAAAE
281|gene|hut        MADAYDQVSVPSEGQPIEVIDEDADELDIPENPIVPIIHGDGIGKDVGPAAQKVLNAAAE
                        *::: .*  *  :   :    ** :*: *::*********.**** **.**.***:

2430|gene|nph       ATGREINWMRVYAGESAREKYDENLPEDTIEALKEFKVSIKGPLTTPVGAGFRSLNVALR
2330|gene|hla       ATGRSIAWMRVYAGGSARDMYDENLPEDTVSAIRDHRVAIKGPLTTPVGAGFRSLNVALR
3212|gene|hwa       ATGRSIEWLRVYAGESARERYGENLPEDTVSAIRDHRIAIKGPLTTPVGAGFRSLNVALR
9930|gene|hbo       ATGRSIEWLRVYAGESARKKYDENLPEDTVQAIKDHRVAIKGPLTTPVGAGFRSLNVALR
13419|gene|hma      ATGRDISWMRIYAGQSARDKYDENLPDDTVEAIKEFNVAIKGPLTTPVGAGFRSLNVALR
647|gene|hhi        ATGRDISWMRVYAGQSARDKYDENLPDDTVEAIKEFNVAIKGPLTTPVGAGFRSLNVALR
1873|gene|nrc1      ATGHDIEWMEVYAGESAREMYDENLPEETVEAIREHRVAIKGPLTTPVGAGFRSLNVALR
281|gene|hut        ATGREIAWMRVYAGESGRERYDENLPDDTVNAIDEFRVSIKGPLTTPVGAGFRSLNVALR
                    ***..* *: :*** *.*. *.****::*:.*: :..::*********************

2430|gene|nph       KKLDLYTNIRPTYHLDGVPSPVKQPEQMDMVTFRENTEDVYAGIEWEAGTDEVQEVKEFV
2330|gene|hla       KTLDLYANVRPTYYLDGVPSPVKNPEKMDMITFRENTEDVYAGIEWEAGTDEVEQVRDFL
3212|gene|hwa       QELDLYANVRPTYHLSGVPSPVKNPSAMDMVTFRENTEDVYAGIEWEAGTAGADEVRDFL
9930|gene|hbo       KKLDLYANVRPTYHLDGVPSPVKNPSAMDMVTFRENTEDVYAGIEWEAGTDEVQQVKEFV
13419|gene|hma      KTLDLYANVRPTYHIEGVPSPVKDPEEMDMVTFRENTEDVYAGIEWEAGTDEVEEVKEFV
647|gene|hhi        KTLDLYANVRPTYHIEGVPSPVKDPEEMDMVTFRENTEDVYAGIEWEAGTDEVEEVKEFV
1873|gene|nrc1      QTLDLYANVRPTYYLDGVPSPMKAPEEMDMVTFRENTEDVYAGIEWEAGTDEAEQVRSFV
281|gene|hut        QTLDFYANVRPTYYLDGVPSPMKAPEEMDMVTFRENTEDVYAGIEWEEGTDEVEEVRDFV
                    : **:*:*:****::.*****:* *. ***:**************** **  .::*..*:

2430|gene|nph       EEQMGYDDVIHDGEVGIGVKPITEFGTKRLVRQAIDYALEKDRDSVTLVHKGNIMKFTEG
2330|gene|hla       EDDMEIADVIHDGPVGIGVKPISEFGSKRLIREAIDYALANDRDSVTLVHKGNIMKFTEG
3212|gene|hwa       ENQMDYDEVMHDGPIGIGIKPITEFGTKRLVRQAIDYALENNRPSVTLVHKGNIMKFTEG
9930|gene|hbo       EEEMGHDDVIHDGPVGIGIKPITEFGTKRLVREAIEYAIENDRDSVTLVHKGNIMKFTEG
13419|gene|hma      EDEMNFDETIHDGPVGIGVKPITEFGTKRLVREAIDYALEEDRDSVTLVHKGNIMKFTEG
647|gene|hhi        EDEMDFDETIHDGPVGIGVKPITEFGTKRLVREAIDYALEEDRDSVTLVHKGNIMKFTEG
1873|gene|nrc1      EDEMDFDDVMHDGDIGIGLKPISEKGSKRLVREAIDYAIENDRDTVTLVHKGNIMKFTEG
281|gene|hut        EEEMGFDETMHDGPIGIGIKPITEYGSKRLVRKAIDYAIEHDRDKVTLVHKGNIMKFTEG
                    *::*   :.:*** :***:***:* *:***:*:**:**:  :* .***************

2430|gene|nph       AFRDWGYEVAREEYGEEVI--TEDTLWEERDG-EPPEDAVVVNDRIADNMLQQILTRTDQ
2330|gene|hla       AFRDWGYEVAEEEYGDDVI--TEDQLWEAHDG-EQPEGTLVVKDRIADNMLQQLLTRTDE
3212|gene|hwa       AFRDWGYEVAEEEYGDITI--TEDELWDEYDG-EQPADTLLIKDRIADNMLQQLLTRTDQ
9930|gene|hbo       AFRDWGYELAAEEFGDVTI--TEDELWEEYDG-EKPEDKIVVKDRIADNMLQQLLTRTAD
13419|gene|hma      AFRDWGYEVAEEEYGEHVI--TEDELWDEYDG-EAPEDSLVVNDRIADNMLQQLLTRTDE
647|gene|hhi        AFRDWGYEVAEEEYGEHVI--TEDELWDEYDG-EAPEDALVVNDRIADNMLQQLLTRTDE
1873|gene|nrc1      QFGDWGMEVAEEEYPDDEVFAAPDSLWEEQDEVDIPEDAVMVEERLADAMLQWMQLRTDE
281|gene|hut        QFGDWGMEVAEEEYPDEEVFAAPDSLWETQDEVDIPEDAVMVEERLADAMLQWMQLRTDE
                     * *** *:* **: :  :  : * **:  *  : * . :::::*:** ***.:  ** :

2430|gene|nph       YDVLAMPNLNGDYLSDACGAQIGGLGIAPGANIGDGRVLAEPVHGSAPKYAGQDKVNPTA
2330|gene|hla       YSVIATMNLNGDYMSDAAGAQIGGLGIAPGINRGHGRCLAEPVHGSAPKYAGQDKVNPTA
3212|gene|hwa       YDVIATMNLNGDYMSDAAGAQIGGLGIAPGGNFGDGLCLAEPVHGSAPKYAGQDKVNPTA
9930|gene|hbo       YDVIATMNLNGDYMSDAAGAQIGGLGIAPGANFGEGLCLAEPVHGSAPKYAGEDKVNPTA
13419|gene|hma      YDVIATMNLNGDYMSDAAGAQIGGLGIAPGANFGSARCLAEPVHGSAPKYAGEDKVNPTA
647|gene|hhi        YDVIATMNLNGDYMSDAAGAQIGGLGIAPGANFGSARCLAEPVHGSAPKYAGEDKVNPTA
1873|gene|nrc1      FDVLAMPNLNGDYLSDAAGAQIGGLGIAPGANFGAGRCLAEPVHGSAPKRAGQDKANPTA
281|gene|hut        FDVLAMPNLNGDYLSDAAGAQIGGLGIAPGANFGDARVLAEPVHGSAPKRAGQNMANPTA
                    :.*:*  ******:***.************ * * .  *********** **:: .****

2430|gene|nph       MILSGRIMLEFMGWDDAADLVRDAVEQTIVDRKVTYDIERQVEDAEKLATSEYAEAVVDN
2330|gene|hla       MILSGREMLDYLGWSDAADLVRDAVEETISSGQVTYDLHRQIEGGEKLATSEFADAVVDK
3212|gene|hwa       IILSGRIMFEYMGWKDAGELVRDAVEQTILDGDVTYDLHRQIEDGTKLATSEFADAVVRN
9930|gene|hbo       MILSGRLMFEYMGWKDAGKLIRDAVEKTISEGDVTYDLERQIEGGNKLATSEFAEKIVEN
13419|gene|hma      MILSGRLMLEYMGWKDAGQLVRDAVEETISSGNVTYDLERQIEGGTKLATSEFAEKVVEN
647|gene|hhi        MILSGRLMLEYMGWKDAGQLVRDAVEETISSGDVTYDLERQIEGGNKLATSEFAEKVVEN
1873|gene|nrc1      LILSGRLLFEYIGWDDASTLVRDAVEDTIESGTVTYDLARQRDDAEEVSSTTYAEAVIDR
281|gene|hut        MILSGRLMFDYMGWDEAADLVRDAVEETISAGKVTYDLERQLEDAEKLGTEEYAEEIVAN
                    :***** :::::**.:*. *:*****.**    ****: ** :.. ::.:  :*: :: .

2430|gene|nph       LYDLA-
2330|gene|hla       IDELA-
3212|gene|hwa       IDELAS
9930|gene|hbo       INELA-
13419|gene|hma      IEKLA-
647|gene|hhi        IEKLA-
1873|gene|nrc1      IEDLA-
281|gene|hut        IEQLA-
                    : .**