HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0260COG0552KOG0781arCOG01227Signal recognition particle GTPasesignal recognition particle receptor

HOG Organism Gene ID Name Annotation
cHOG0260 nrc1 VNG2462 dpa signal recognition particle receptor
cHOG0260 hmu HMUK1229 Hmuk_1229 signal recognition particle-docking protein FtsY
cHOG0260 hma RRNAC3118 dpa signal recognition particle receptor
cHOG0260 hwa HQ3419A ftsY signal recognition particle receptor SRalpha
cHOG0260 hla HLAC0821 Hlac_821 signal recognition particle-docking protein FtsY
cHOG0260 hbo HBOR01030 Hbor_01030 signal recognition particle-docking protein FtsY
cHOG0260 hut HUTA1328 Huta_1328 signal recognition particle-docking protein FtsY
cHOG0260 hvo HVO_0120 HVO_0120 dpa signal recognition particle receptor-like protein
cHOG0260 nph NP0182A ftsY signal recognition particle receptor SRalpha
cHOG0260 hhi 385 ftsY signal recognition particle receptor
MUSCLE (3.6) multiple sequence alignment


2462|gene|nrc1      MFDGLKDKLSNFREDAEEVAEENAEELADQPDDEAADTEAAAADSAPEDAPAT-------
3419|gene|hwa       MFDGLKNKLDQFRDDVEETTTEKSATDEASSGDDAEPNVKQSDESVSHMPSEAAN-----
1328|gene|hut       MFDGLREKLGRFSDDVEEDVDAVEEGEADDIDDSGADAEAPGEGGSAGDVTQS-------
13118|gene|hma      MFDGLKDKLSGFTSDVEEDVDDDALEAEDEPDADEADGEAPPDQATESDPVADAQASEG-
385|gene|hhi        MFDGLKDKLSGFTSDVEEDVDDDALEAEDEPDADGADGEATADQAADAEPATDSQPSED-
182|gene|nph        MFEGLKDKLSSFKGDVEEQADE-PDSEADAAEPETADAEAAAEPEASSTDTDT-------
821|gene|hla        MFDGLKDKLSGFRKDVEENAE----VEEPAEQDEAETGESPAAESSEDAPAAE-------
1030|gene|hbo       MFDGLKKKLNSFRENVEDTAEEKAEAQAEAAEAAADTTDADTETETPDAETHDADATEAV
                    **:**..**. *  :.*: .                                        

2462|gene|nrc1      ----------------ADAAAPATEPAGEQ------------------------------
3419|gene|hwa       ----------DTSEQTPDDNTHTSNSDVTTAESDISANTDGDPNIDTDSSSLASQEAAAV
1328|gene|hut       ----------AAESDASSQSDADAESTVDTQPADGT----------------AATETSAE
13118|gene|hma      ----------DTAEPTAETDQPQADSEPPAADSEATAESATASATAVEDAD-AVPDEESH
385|gene|hhi        ----------DTQAAAVESDQPQTGSEPPAADSDAIDEPATASSTAVEDTD-AIQDEVSQ
182|gene|nph        -----------------GEPDSVTEPEPDS------------------------------
821|gene|hla        ----------------SDASAAESPTEVDSAADD--------------------------
1030|gene|hbo       GGENEPTETTADSATVSDADDTTSETEAETADAQASPAPDSETPETGDESGDTADDSAA-
                                           : .                                  

2462|gene|nrc1      -PDADDEESSAGF----------------------VSRAASMARGRVVIDEADLEAPLRE
3419|gene|hwa       LDETAQSDNKPGR----------------------LKRAAAFATGKIVIEEEDLEEPLWQ
1328|gene|hut       PDASTEDAAEPDR--------------------GVAERAKLFATGKTVIDEDDLQDHLDD
13118|gene|hma      PDDAAETEEDAATEAESESDEDDDDG-----GRGLAAKAKLMATGKTVIEEEDLQSHLDD
385|gene|hhi        SDDATEVEDDSASDTDSES-EEDDDG-----GRGLAAKAKLMATGKTVIEEEDLQSHLDD
182|gene|nph        -DPETDAEDDPGL----------------------AKKAALAATGRTIITEEELEEPLEQ
821|gene|hla        -DDADADDNDPST----------------------FQRAKAFATGRIIIEEEDLEEPLWD
1030|gene|hbo       -DEADEAASSRERLASDAANEALESGQKESSGAGRLKRAAAFATGKVIIEEEDLEDPLWE
                             .                           .*   * *. :* * :*:  * :

2462|gene|nrc1      LEFALLESDVEMSVVEEILDQIRGDLVGEERKFTESTDTLIEDALREALLSVIDVGQFDL
3419|gene|hwa       LEMALLESDVEMQVAEEILGTIRSKMLGETRAQVNTTAALVEEALSDALYEVISVGQYDF
1328|gene|hut       LELALLSSDVEMSVAGEILDGVEANLVGETRRRLQSTGNLVQDSLREALYDVISVGQFDF
13118|gene|hma      LELALLSSDVEMSVANEILDGVKENLTGQTRRRLSSTGNLVRDALRESLYDVINVGQFDF
385|gene|hhi        LELALLSSDVEMSVANEILDGVKENLTGQTRRRLSSTGNLVRDALRESLYDVINVGQFDF
182|gene|nph        LELELLQGDVEMSVAQEITDRIREELVGETRKQVESGEQVVERAIAEALRDVISVGQFDF
821|gene|hla        LEMALLESDVEMSVAERILDTVREKMLGESRKQVETTGELVESALHDALLDVIAVGQFDF
1030|gene|hbo       LEMALLESDVEMHVAEEILDTIREKMVGETRRQVETMGQLVQEALHDALYDVISVGQFDF
                    **: **..**** *.  * . :  .: *: *   .:   ::  :: ::* .** ***:*:

2462|gene|nrc1      VDEIESTSKPVTIVFTGVNGVGKTTTIAKLARYLESEGFSSVLANGDTYRAGANQQIEEH
3419|gene|hwa       DSRVESADSPVTIVFTGVNGVGKTTSIAKLVQYLESRGLSVVMANGDTYRAGANEQIREH
1328|gene|hut       EERIAAAEKPVVIVFTGVNGVGKTTTIAKLAQYLEDRGHSSVLANGDTYRAGANQQLGEH
13118|gene|hma      DERVQQADKPVTIVFTGVNGVGKTTSIAKLAQYFEDRGLSTVLANGDTYRAGANEQLEKH
385|gene|hhi        DERVQQADKPVTIVFTGVNGVGKTTSIAKLAQYFEERGLSTVLANGDTYRAGANEQLEKH
182|gene|nph        ESRIADAEKPVTIVFTGVNGVGKTTSIAKLARWFEERGHSSVLANGDTYRAGANEQIEEH
821|gene|hla        EERIAEADKPVTIVFTGVNGVGKTTSIAKLSEWLADRGYSSVMANGDTYRAGANEQIQEH
1030|gene|hbo       DQRIAEADKPVTLIFTGVNGVGKTTSIAKMARYFEKQGLSVVLANGDTYRAGANEQIRKH
                     . :  :..**.::***********:***:  :: . * * *:***********:*: :*

2462|gene|nrc1      AEALGVKCITHEQGGDPTAVVYDAVEYADANDVDVVLGDTAGRLHTSDDLMSQLEKLDRV
3419|gene|hwa       AKTLDTKLIAHEQGGDPAAVLYDAVEYAEANDIDVVLGDTAGRLHTSNDLMAQLEKIDRV
1328|gene|hut       AEALDVPYISHEQGGDPTAVIYDAVEYAEANDVDVVLGDTAGRLHTSEGLMDQLSKIERI
13118|gene|hma      AENLDKKIITHEQGSDPTAVVYDAVEYAKANDIDVVLGDTAGRLHTSDDLMAQLEKIDRN
385|gene|hhi        AENLDKKIITHEQGSDPTAVVYDAVEYAKANDIDVVLGDTAGRLHTSDDLMAQLEKIDRN
182|gene|nph        ADALDKKIITHEQGGDPAAVIYDAVEYAEANDVDVVLGDTAGRLHTADDLMAQLEKIDRV
821|gene|hla        ADRLDRELISHDQGGDPAAVIYDGVEYAEANDIDVVLGDTAGRLHTSDDLMAQLEKIDRV
1030|gene|hbo       AENLDTKIISHEQGGDPAAVIYDAVEYAEAHDIDVVLGDTAGRLHTSNDLMAQLEKIDRV
                    *. *.   *:*:**.**:**:**.****.*:*:*************::.** **.*::* 

2462|gene|nrc1      VDPDVTVFVDEAVAGQDAVNRAREFDEASAVDGTILTMADADSQGGAAISVSHVTGKPIL
3419|gene|hwa       VNPDMTLFVDEAVAGQDAVERAKQFNEAAEIDGTVLTKADADSNGGAAISIAYVTGKPIL
1328|gene|hut       IEPDMTLFVDEAVAGQDAVTRATEFDAAAEIDGTILTKADADPQGGAAISIAHVTGKPIL
13118|gene|hma      IDPDMTLFVDEAVAGQDAVNRAREFNDAAEIDGAILTKADADPQGGAAISVAHVTGKPIL
385|gene|hhi        IDPDMTLFVDEAVAGQDAVNRAREFNDAAEIDGAILTKADADPQGGAAISVAHVTGKPIL
182|gene|nph        VDPDLTLFVDEAVAGQDATNRAKEFNDAAEIDGAILTKADADSQGGAAISIAHVTGKPIL
821|gene|hla        VAPDMTLFVDEAVAGQDAVNRAKEFNDAAEIDGAVLTKADADSSGGAAISVAYVTGKPIL
1030|gene|hbo       VEPDLTLFVDEAVAGQDAVERAKQFNEAAEIDGAVLTKADADSNGGAAISIAYVTGKPIL
                    : **:*:***********. ** :*: *: :**::** ****..******:::*******

2462|gene|nrc1      FLGTGQAYEDLEPFDPDALVDDL-LAASDD-
3419|gene|hwa       FLGVGQEYDDIERFDPKSMVNQL-LGETESR
1328|gene|hut       FLGTGQGYDHLERFDPEEVVDQLTLGE----
13118|gene|hma      FLGTGQDYDDLDPFDPEEIVDSL-IGE----
385|gene|hhi        FLGTGQDYGDLEPFDPEEIVDSL-IGE----
182|gene|nph        FLGTGQGYDDIERFDPDEIVSRL-LEA----
821|gene|hla        FLGTGQGYDDLTLFDPEELVESL-LSEN---
1030|gene|hbo       FLGVGQGYDDIEQFDPERMVERL-LGEDE--
                    ***.** *  :  ***. :*. * :