HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0026COG3413arCOG02280Predicted DNA binding proteinbacterio-opsin activator-like protein

HOG Organism Gene ID Name Annotation
cHOG0026 nrc1 VNG1488 boa2 bacterio-opsin activator-like protein
cHOG0026 hmu HMUK1680 Hmuk_1680 Bacterio-opsin activator HTH domain protein
cHOG0026 hma RRNAC1193 boa bacterio-opsin activator-like protein
cHOG0026 hma RRNAC3490 boa2 bacterio-opsin activator-like protein
cHOG0026 hwa HQ1863A DNA binding protein, bacterio-opsin activator-like
cHOG0026 hla HLAC0320 Hlac_320 Bacterio-opsin activator HTH domain protein
cHOG0026 hbo HBOR30680b Hbor_30680 predicted DNA binding protein
cHOG0026 hbo HBOR34990b Hbor_34990 predicted DNA binding protein
cHOG0026 hut HUTA2711 Huta_2711 Bacterio-opsin activator HTH domain protein
cHOG0026 hut HUTA0019 Huta_0019 Bacterio-opsin activator HTH domain protein
cHOG0026 hvo HVO_0492 HVO_0492 boa bacterio-opsin activator-like protein
cHOG0026 nph NP1538A pterin cluster protein ( DNA binding protein)
cHOG0026 nph NP1564A DNA binding protein
cHOG0026 hhi 1793 boa5 bacterio-opsin activator-like protein
cHOG0026 hhi 710 boa1 bacterio-opsin activator-like protein
MUSCLE (3.6) multiple sequence alignment


19|gene|hut         --MEGIRAKLVIEEPPQCDVAAVSRDCG-PVASVSRSAVPDEDGRVHDEFTVR---E--G
1863|gene|hwa       -MPDGIRTELAVHNPTNCPVSTISATQEGSVTDINWTGQGAN-ETVTEEFRVSQDIS--S
11193|gene|hma      -MSGRILAEVEVFGPRSCHVQPHADE-EWSVSSVSRSVTSAAADPVIEEFTLKGGDGPPS
1793|gene|hhi       -----MLAEVEVFGPRSCQVQPHADE-EWSVSSVSRSATSGDADRVLEEFTLKGGDDHPG
34990|hp|hbo        MTGQGVHAEVEVVTGAGCRIGNMPQKTE-EISSISRSTMPSE-DSVTVDFT--------A
2711|gene|hut       --MPGMRAEIEVLSPEACPVAGLSEQADDPLTSVSRAGNAE--GTVTEEFTV----S--G
1538|gene|nph       ---MGLEAAVKIPNPEQCPVADVSAEADARVGDVSWSGVPNDDGSVVEEFEL----D--T
1488|gene|nrc1      -MPAGIRVTVSFPRPPVCPIAVLSERANTTITNVSTSIAAD--GAPVTEFLI----D--A
30680|hp|hbo        -MPPGIRATVAFTTPDLCPIVELSDAAEITVDSVATNVPASDCGECVTEFSA----D--A
320|gene|hla        -MGSGIRAEVSLPTASPSPFDGVVDG-STPIYSVARSSSNGDPETVVLEFIA----D--A
1564|gene|nph       -MSAGIRAEVRVDGGGSCPVAVASADAGTPTYSVARSVTGSDPDRVTEEFMLAA--E--G
13490|gene|hma      MSDSGIRVELSVDAPGACPVASVSDEAGTAVTDVARSSPDAD-GQVIEEFTATGTDD--G
710|gene|hhi        -------MELSVDTPGACPVASVSDEAGAAVTDVARSSPDED-GQVIEEFTATGTDE--G
                             : .     . .            .:              :*          

19|gene|hut         DCPDTLGDATAIFQDDRRTIYRLARSRGQ--GCACECIEREGCTVRDVQVVDGTLFVTVL
1863|gene|hwa       AVESDFECAEPVVDVGDERVYRFKRNHEE--ACACEIVESSGAPVADVRARSGVLHLTLH
11193|gene|hma      VLQTDGLNVDHVFAYEQRHVFQLSRAAGQ--GCVCERIEAAGCVVHEFTADTESLVVTFL
1793|gene|hhi       ALQSELPNVDHVFAYDQRHVFQVSRAAEQ--GCVCERIEAAGCVVQKFTADTESIVVTFL
34990|hp|hbo        ESGTEFNSTEEVFHYDDKTVHRFECKTGTTPSCPCEFVESRGCPVRSFRTTENALVVQFV
2711|gene|hut       DATLTDDRLSQLFEYRSASVYRFHHES-L--DCVCEFVEDHDHPISEIRAQDGSLVLSLH
1538|gene|nph       DA-DPPDDMEKVFGDNRYSIYRFDRAGDA--PCICQRIETFGCPVADVEAVDGSLRIVFR
1488|gene|nrc1      DAVPDDYDRDPVFTYTDRHLYRVRHDAEA--ACPCVCLGAHDTPVNRYRARDGELQIVFH
30680|hp|hbo        DA-DSETDLTPIFSHGPTNRYRFTHDDGV--NCPCECLGQFGCPVARYVAQDGHLTLVFH
320|gene|hla        DL-PVSEGVEVVFDYGAKAAYRFKVPRVE--ASPFAILDRHSVPVSETTIRDGRLVVTFH
1564|gene|nph       TP-DAGTDLEAVFDYGSKTMYRFSRERGV--GCPCEVIEVEDCPVVDIHTRDGNLHLVFH
13490|gene|hma      AI-EAREDMEKVFVTGNGTRYQFSRSR-T--ECVCEAVETYDCPVADIRAEGGQLRLTFH
710|gene|hhi        AI-EAREDMDKVFATGNGSRYQFSRSR-T--ECVCEAVETYDCPVADIRAEGGQLHLTFH
                               :.       ...         .    :   .  :         : : . 

19|gene|hut         AADLDGIRAIVSTLRESRDGVQVGTLVR-APPESESGPL--WVTDPGELTARQREVLETA
1863|gene|hwa       LESVDKLRTIVDKLDDAAERVELRYLVH-ADASGGSDEPDRALVDRGALTDRQQEVLQTA
11193|gene|hma      VDDVPTLREIVADLQSEGEAVKLRRLLE-DTPTEADRP---VVLDRAKLTSRQREVLARA
1793|gene|hhi       VDDMPTLRDIVADLQSEGETVKLRRLLE-DTSTETDQP---VVLDRAKLTNRQREVLSQA
34990|hp|hbo        ARDIRNLREIVVGLREQFPDVSLRRLTR-SQEPEANNNL--VLINRDTLTERQQEVLETA
2711|gene|hut       LTTIQDLRDLVTDLRERYGAVRIRYLLQVESDEEGSTDV--IPIDRSRLTDRQKEVLETA
1538|gene|nph       PADVESLQEIVGTLQREFGGIQLEHLVQ-SSEPTEGET---VVVDRGRLTDRQREVLETA
1488|gene|nrc1      GREFDTVQAIVGELRAEFADIDIQRLVR-APTGTAAQDT--AFVDRGQLTDRQLEVLTTA
30680|hp|hbo        AADYEELRSVVAELRDRFPDVDIKRFVR-SPAVEQSQDS--VFVDRSKLTTRQLEVLQTA
320|gene|hla        ATDLPTLRSVLDEFRESCSDMQVLRLLQ-SSSTPEESDL--VTVDRSELTERQREVLTAA
1564|gene|nph       AADMETLQEVIFSLRERFPSVDVQRLLR-DQHEAPEDNL--ILLDRSRLTDRQREVLETA
13490|gene|hma      APDVDRVRAIVTRLKELYDGVSLRSMRR-NGDVDPVDS---ILVDRSKLTDRQQEVLETA
710|gene|hhi        APDVDRVRAIVTRLKELYDGVSLRSMRR-NGDVDPVDS---ILVDRSKLTDRQQEVLETA
                          :. ::  :      : :  :                  :   ** ** ***  *

19|gene|hut         YEMGYFEYPRNATAEAVATELDVATPTFTEHLAAAQRNLLEGFLDGSDNQSDTTIQSSHG
1863|gene|hwa       YSMGYFQYPRDANATTVADELGIGLSTFTEHLAVAQRKLLSELLSQRV------------
11193|gene|hma      HEMGYFEHPRDATAGDVADALDISTSTFTEHLAAAQRKLLDDLLDSC-------------
1793|gene|hhi       HQMGYFEHPRDATAGDVAEALDISTSTFTEHLAAAQRKLLDDLLDSH-------------
34990|hp|hbo        HEMGYFGHPKDANATEVANALDINRSTFAEHLSAAQSKLLDSILEF--------------
2711|gene|hut       YRMGYFSYPRDANATDVAAELDIDGSTFTEHLAAAQSKLMDELLAEM-------------
1538|gene|nph       YEMGYFEHPKGANAGEVADELGINSATLRGHLSAAQSKLLDEMLA---------------
1488|gene|nrc1      YEAGYFERPRGATAQALADDLGIAPSTFTEHLLAAQRKLLGDALETDGT-----------
30680|hp|hbo        YDMGYFERPRRANATEIAAELDINPSTLTEHLAAAESKLLEDIL----------------
320|gene|hla        YDAGYFDHPKGANAGEVAESLGIDRSTFSEHMAAAQRKLLSALLD---------------
1564|gene|nph       HEMGYFEHPMGANAGEVADELDITTSTFSEHLAAAQSKLLDAILDA--------------
13490|gene|hma      VDMGYFEYPKGANAGDVATELDISVSTFAEHLAAAQTKLLDSIVAE--------------
710|gene|hhi        VEMGYFEYPKGANAGDVASELDISVSTFAEHLAAAQTKLLDSIIAE--------------
                       ***  *  *.*  :*  *.:  .*:  *: .*: :*:   :                

19|gene|hut         Q
1863|gene|hwa       -
11193|gene|hma      -
1793|gene|hhi       -
34990|hp|hbo        -
2711|gene|hut       -
1538|gene|nph       -
1488|gene|nrc1      -
30680|hp|hbo        -
320|gene|hla        -
1564|gene|nph       -
13490|gene|hma      -
710|gene|hhi        -