HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0259COG3364arCOG04417/1Zn-ribbon containing proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0259 nrc1 VNG2406 vng2406 no entry
cHOG0259 hmu HMUK0812 Hmuk_0812 conserved hypothetical protein
cHOG0259 hma RRNAC2708 hypothetical protein
cHOG0259 hwa HQ3736A hypothetical protein
cHOG0259 hla HLAC2744 Hlac_2744 hypothetical protein
cHOG0259 hbo HBOR02080 Hbor_02080 Zn-ribbon containing protein (DUF2072)
cHOG0259 hut HUTA1617 Huta_1617 conserved hypothetical protein
cHOG0259 hvo HVO_3012 HVO_3012 conserved hypothetical protein
cHOG0259 nph NP0590A hypothetical protein
cHOG0259 hhi 3103 HAH_3103 hypothetical protein
cHOG0259 hhi 4184 traD2 putative conjugative transfer protein TraD
MUSCLE (3.6) multiple sequence alignment


4184|gene|hhi      MSSSSSAPPGQRSGEVPNSLKYDNVVGFVWAGFMLLFPPMIVDSDKVLPKRFWAWRYIYL
3736|hp|hwa        -------MPHECTN----------------------------------------------
2080|gene|hbo      -------MPHQCTN----------------------------------------------
1617|chp|hut       -------MPHQCTS----------------------------------------------
12708|hp|hma       -------MPHQCTD----------------------------------------------
3103|hp|hhi        -------MPHQCTD----------------------------------------------
590|hp|nph         -------MPHQCTG----------------------------------------------
2744|hp|hla        -------MPHQCTT----------------------------------------------
2406|chp|nrc1      -------MPHQCTN----------------------------------------------
                           * : :                                               

4184|gene|hhi      GFGLISTAFFYDVLVQTPSAALLFPFAHVLAAISVGTLFADFTVPGLSLPMVSYSTTVLL
3736|hp|hwa        ----------------------------------CGRVFPD-------------------
2080|gene|hbo      ----------------------------------CGKVFAD-------------------
1617|chp|hut       ----------------------------------CGTVFDD-------------------
12708|hp|hma       ----------------------------------CGRGFDD-------------------
3103|hp|hhi        ----------------------------------CGRGFDD-------------------
590|hp|nph         ----------------------------------CGHTFED-------------------
2744|hp|hla        ----------------------------------CGRTFPD-------------------
2406|chp|nrc1      ----------------------------------CGHVFAD-------------------
                                                      *  * *                   

4184|gene|hhi      YAISIGIVFSGELLRRTSPEMLAMNQWDHDDGESVVPLEEVSHEHEEAEMPFTLDQDVST
3736|hp|hwa        ----------------GSKQMLS-------------------------------------
2080|gene|hbo      ----------------GSKEMLS-------------------------------------
1617|chp|hut       ----------------GSTEMLS-------------------------------------
12708|hp|hma       ----------------GSKEMLS-------------------------------------
3103|hp|hhi        ----------------GSKEMLS-------------------------------------
590|hp|nph         ----------------GSKEMLS-------------------------------------
2744|hp|hla        ----------------GSKEMLS-------------------------------------
2406|chp|nrc1      ----------------GSKEMLS-------------------------------------
                                    * :**:                                     

4184|gene|hhi      AVVGETGSGKTSMMKLLAYQFPYYSNTAVIAHDTGEDFQAFYEELGFDVQRIRHEDSDVV
3736|hp|hwa        ---GCPDCG-------------------------GNKFQ---------------------
2080|gene|hbo      ---GCPNCG-------------------------GNKFQ---------------------
1617|chp|hut       ---GCPECA-------------------------GNTFQ---------------------
12708|hp|hma       ---GCPNCG-------------------------GNKFQ---------------------
3103|hp|hhi        ---GCPNCG-------------------------GNKFQ---------------------
590|hp|nph         ---GCPECG-------------------------GNKFQ---------------------
2744|hp|hla        ---GCPDCG-------------------------GNKFQ---------------------
2406|chp|nrc1      ---GCPDCG-------------------------GNKFQ---------------------
                      * . ..                         *: **                     

4184|gene|hhi      WNLFKDADSESDFREVAGAIFGEADGHDPFHRPAKQTFAEMLMYLHLSAKKNSRRHALCH
3736|hp|hwa        ---FRPSSQESES-----------GMQSDPQRSDPDRDSQPQS-----------------
2080|gene|hbo      ---FSPSGSDSDD-AAETTTRQQTSSSGTTPSSGSAADATTDR-----------------
1617|chp|hut       ---YHPGGTESTG--------ESAPDAAPPERPEPD---DSVA-----------------
12708|hp|hma       ---YQPEGADISE----------TPDAEPPEPPGPD---STVA-----------------
3103|hp|hhi        ---YQPEGADISE----------TPDAEPPEPPGPD---STVA-----------------
590|hp|nph         ---FRPSEEALSD---PTDGDSSPPDEEPPEPPAADSTTSSVA-----------------
2744|hp|hla        ---FKPAGETSAE-------QRSPAGNQPSNTDPQSPDANRQS-----------------
2406|chp|nrc1      ---YHPSEIPADS-----------PSGDPTPSDGSDADSSTVS-----------------
                      :                                                        

4184|gene|hhi      ADIVSLLNEGHIALKKALDEFDRLDSGHIDPDKG-----KGAQNVYQTIKE----NVDPV
3736|hp|hwa        ------------------------------DTHS-----AANHQNESKINT----NTQP-
2080|gene|hbo      -------------------EPNTNRESASDDTAGSTTWQRAASRAAD-VEERRSANQTPS
1617|chp|hut       ------------------------------RTVG-----NAAQTVKNFIG-----SDEP-
12708|hp|hma       ------------------------------RTVG-----KTAASVRDFVSGSTTDGDRP-
3103|hp|hhi        ------------------------------RTVG-----KTAASVRDFVSGSAPDGDRP-
590|hp|nph         ------------------------------ETVG-----RATTRVRDLVSS----SEQP-
2744|hp|hla        ------------------------------PDAN-----RQSAPVDEGAPD----ESAG-
2406|chp|nrc1      ------------------------------GAVG-----RAADRVRDAVAE----ADTP-
                                                    .            .             

4184|gene|hhi      FTGDFGDYGEFSLQEYIENPEGRVLIIDSNPTELETLGPMYQLLADWSIRYAMNASNPTV
3736|hp|hwa        ---------------S---PSN----------------------TDPVP-KPDTTEYDGV
2080|gene|hbo      GSADDGGRSDTRSHKTQNRSADQTNDNIDSARRSEKTLREWANSRGFASEVEDANDETTL
1617|chp|hut       --------------TPGVDPDE----------------------ADPLSPWPGDAEDAAT
12708|hp|hma       ------------------------------------------------------AEQSHL
3103|hp|hhi        ------------------------------------------------------AEQSHL
590|hp|nph         ------------------APDE----------------------TAGTTNTASDAEAPTG
2744|hp|hla        ----------------------------------------------------RVTDTPAP
2406|chp|nrc1      ------------------------------------------------------ADDPTP
                                                                          .    

4184|gene|hhi      HIL----DEIDALPALTQVTNLTARGRKHKARALVGVQTIGQLKDTYSTISGIVGNCPQG
3736|hp|hwa        GAG----SSPEHKRTTN-------------------------------------------
2080|gene|hbo      RENRRRTGDAQRRPSERRSSSSARQS----------------------------------
1617|chp|hut       VDG----DTSPARPETG-------------------------------------------
12708|hp|hma       DAD----RSADAQPSDP-------------------------------------------
3103|hp|hhi        DAD----RSADSQPSDP-------------------------------------------
590|hp|nph         DDL----ETPSSSSAST-------------------------------------------
2744|hp|hla        DSQ----RSDSQPSEAR-------------------------------------------
2406|chp|nrc1      DDE----GDTQSDPAAD-------------------------------------------
                                                                               

4184|gene|hhi      VYFGPGDSESTDFILDELGESRQYDRSEMVSMSHQGRGENPRTQARDTYKEKDKTPVTSG
3736|hp|hwa        ---TSTDNEHTN-----------------QSDSDSQFDPWPHADPNQGNEENDDNTDPIS
2080|gene|hbo      ---SPSDRQSSD-----------------DAQSDSSVPTDSSSASPET-TASKETKTPTG
1617|chp|hut       ---GPTAGG----------------------AENDSVSAEPQTD-SDR------------
12708|hp|hma       ---SHTSGS-------------------------------PSTE-PDR------------
3103|hp|hhi        ---SHTSGS-------------------------------PSTE-PDR------------
590|hp|nph         ---EPAAGTAGS-----------------DTDSNSGSGPDPEAEWPGNWSGSDSDASEAG
2744|hp|hla        ---TPDAGT-------------------------------PESETPDA------------
2406|chp|nrc1      ---SPGAGA-------------------------------PDAD-PGV------------
                                                           . :                 

4184|gene|hhi      LLRDFQPGECVAVSRTTWVHGQSYELADVRDSLPAQGAESPGSSEPEPTEDDTDIESDSW
3736|hp|hwa        TPHHADHPTPDTTTSAEDSKLHNPSEKDDENN--AQASARGDIVSPEELAAMGASSDAEG
2080|gene|hbo      TPAPSDEPAPSSKQAKSSAADPSVFGDDVEDD--AQASARSDVVSPDEIAAAQPDDRPSD
1617|chp|hut       --------------------GETVRTAGIEGE--AQASARSAVVSPEELSEATGGTNVAV
12708|hp|hma       -------------------------ASAAEDS--AQASARGDIVEPDELPSDAPSASESE
3103|hp|hhi        -------------------------TSATEDS--AQASARGDIVEPDELPSDAPSASEAE
590|hp|nph         ESPPSGASDPSASSGDDARDSEILDDSAGENS--AQATARSDVVSPDELNAVARSDPSPT
2744|hp|hla        ----------------QKTDSEHVRDRTEEDV--AQASARSDVVSPDELDRASRDIETDS
2406|chp|nrc1      ----------------------RAATPDDEDG--AQATARSEVVDVSTLPDQP-------
                                                 .   **.:      . .             

4184|gene|hhi      FSFTRARLDDVLYGSLGEDDDDESRE-------------------SGPDRDPEVEPTVDA
3736|hp|hwa        HPQQEVQSH----LESLDSSSKDPSQ------TSTGDSQSSSESSTDTDD-PGL------
2080|gene|hbo      AD-----------GRVIEPESDDR---------------------------PDL------
1617|chp|hut       GSNGGAVAA----GTANGEQADDDRT-------------------PTEDR-PDL------
12708|hp|hma       HQFRPV-------GADPDPPAEPDRE----------------------DR-PDL------
3103|hp|hhi        HQFRPV-------GADPDPPAEPEQE----------------------DR-PDL------
590|hp|nph         DT-D---TT----ASPPEEPVSHDEPSASSDTPPEADADTTSASSPDDDQ-PDL------
2744|hp|hla        S------ST----GSDPDTPTDPEGP-----------------------R-PDI------
2406|chp|nrc1      -------TD----GRVVEEPDTDEAE-------------------------PDL------
                                                                      * :      

4184|gene|hhi      TDGLGDDESSDPLDQTTANTAVTSPDTDHPNLSDSEDEYDGGDHDQQSDDNTGGLFSEPD
3736|hp|hwa        ------DDLRTELNQQFESIRIVAPGQYELNLME--------------------LYDRSE
2080|gene|hbo      ------DELREELNDQFESIKIVAPGEYELNLME--------------------LYDRPE
1617|chp|hut       ------AELREELNDQFESIRIVEPGQYELNLME--------------------LYEREE
12708|hp|hma       ------EELRAELNDQFESIKVLEPGQYELNLME--------------------LYDREE
3103|hp|hhi        ------EELRAELNDQFESIKVLEPGQYELNLME--------------------LYDREE
590|hp|nph         ------AALREQLNEQFESIKIVEPGQYELNLME--------------------LYDREE
2744|hp|hla        ------DDLRDELNEQFESIRIVSPGKYELNLME--------------------LYDRQE
2406|chp|nrc1      ------EDLREELNDQFESIRIVAPGQYELNLME--------------------LYDRQE
                               *::   .  :  *.    ** :                    *:.  :

4184|gene|hhi      PDPSLGGTESAEQEGGESPTESDAEGDSNETEERDETESKEEERDVSEFM
3736|hp|hwa        YIISL-------QEDGRYVIEVPNAGRELSDDTN----------------
2080|gene|hbo      YIISL-------REDGRYVIEVPDTWDSHDDDR-----------------
1617|chp|hut       YIIAL-------QEDGRYQIQVPDTWQE----------------------
12708|hp|hma       YIIAL-------QEDGHYSIQVPETIRSE---------------------
3103|hp|hhi        YIIAL-------QEDGHYSIQVPETIRSE---------------------
590|hp|nph         YIIAL-------QENGRYVIQVPEQWMGDDPDER----------------
2744|hp|hla        YIISL-------QEDGRYVIEMPDAWGISDE-------------------
2406|chp|nrc1      YIIAL-------QEDGQYVIEVPDAWEAADPTDVE---------------
                      :*       .*.*    :