HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0258COG1109KOG2537 KOG1220arCOG00767Phosphomannomutasephosphomannomutase

HOG Organism Gene ID Name Annotation
cHOG0258 nrc1 VNG0905 pmu2 phosphomannomutase
cHOG0258 hmu HMUK2740 Hmuk_2740 phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I( EC:5.4.2.8 )
cHOG0258 hma RRNAC0444 manB2 phosphoglucomutase/phosphomannomutase
cHOG0258 hwa HQ1522A pmm3 phosphohexomutase 3 (phosphoglucomutase); phosphomannomutase)
cHOG0258 hla HLAC1418 Hlac_1418 phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
cHOG0258 hbo HBOR18320 Hbor_18320 phosphomannomutase( EC:5.4.2.8 )
cHOG0258 hut HUTA1384 Huta_1384 phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
cHOG0258 hvo HVO_1402 HVO_1402 pmu phosphomannomutase
cHOG0258 nph NP3514A pmm_3 phosphohexomutase 3 (phosphoglucomutase, phosphomannomutase )
cHOG0258 hhi 1188 manB1 phosphoglucomutase/phosphomannomutase
MUSCLE (3.6) multiple sequence alignment


1522|gene|hwa       --------MGLFGTAGIRGDVTTTVTPSLALEIGRALGVDAAAEDA-----EVVIGRDGR
1384|gene|hut       ------MTMDLFGTTGIRGPVATKVTPELALSVGRAAGQYGA---------EFVIARDGR
10444|gene|hma      --------MELFGTAGIRGDVVSKVTPDLALRVGQATGRDGE---------TFVLGYDGR
1188|gene|hhi       --------MELFGTAGIRGDVVSKVTPDLALRVGQATGRDGE---------TFVLGYDGR
3514|gene|nph       --------MDLFGTAGIRGAAQTDVTPSLALAAGRAAAEDGA---------TFVVGRDGR
905|gene|nrc1       MDDTDDGRVELFGTAGIRGDAVETVTPQLALAVGTAAATTAPGDTP-----EFVVSRDGR
1418|gene|hla       --------MDLFGTAGIRGSAETRVTPELALAVGRAVAAEVRAAEEGTRPDEVVLARDGR
18320|gene|hbo      --------MELFGTAGIRGDVVTRVTPELALSVGRAVGMDAVASDGRA---EVVVGRDGR
                            : ****:**** .   ***.***  * * .              .*:. ***

1522|gene|hwa       TSGPGLAAAVESGVLAAGVDVTRVGVVPTPALAYASKGQYGVMLTASHNPPADNGIKLFR
1384|gene|hut       ETGVAIAAALEAGLESAGADVVRAGMLPTPALGFASYGRHGVMITASHNPSPDNGIKFFV
10444|gene|hma      VTSPALADAMAAGLQSAGARVVRIGRVPTPTLAYASQGRHGVMITASHNPPTDNGIKLFA
1188|gene|hhi       VTSPALADAMAAGLQSAGARVVRIGRVPTPTLAYASQGRHGVMITASHNPPTDNGIKLFA
3514|gene|nph       ETGPALAAAVEAGLESGGADVYRLGAVPTPTLAYASRGRRGIMVTASHNPPADNGLKFFV
905|gene|nrc1       ETGPALIAAVTAGLAAGGARVIRGGVLPTPALAYASRGRRGIQVTASHNPPSDNGIKLFA
1418|gene|hla       VTGPAIAAAMESGLASGGVRVLRAGRLPTPALAHASQGRYGVMLTASHNPPTDNGIKLFR
18320|gene|hbo      TSGPALASAVEAGLESAGADVHRVGVVPTPALAFASRGRRGIMLTASHNPPTDNGIKVFV
                     :. .:  *: :*: :.*. * * * :***:*..** *. *: :******..***:*.* 

1522|gene|hwa       QGTEYTRDREKIIESRVTAENTPVSWQTWGTTAHAEIISGYRDTVLTYANRYGKTPAELT
1384|gene|hut       DGEEYTTADEERIEERVANDAQPATWDEWGRQRSEEPLDAYLDAVVEYAREHGNPLDGMT
10444|gene|hma      DGTEYGDDDETRIEGRIEGGSTPTAWRDWGDTESVDYLDEYRGAVADYAESLGGDPSRLT
1188|gene|hhi       DGTEYGDDDETRIEGRIEDGSTPTAWRDWGDTESVDYLDEYRGAVADYAESLGGDPSGLT
3514|gene|nph       DGTEYDRDAERRVESRVLSDPSPVEWDEWGDSYRMDVLEAYRTAVVEYVKTSFGDCEGLR
905|gene|nrc1       DGREYDSDAERAIETRVAADTEYAAWAEWGSAESATVRPDYRAAVEAFARDHGAPLDGTT
1418|gene|hla       DGSEFDREAERAVEERVAGEEPPAAWDEWTETERVDTLDGYLDAVRAYAEGFGDDLDGLR
18320|gene|hbo      DGEEYDRTLERGVEERVASDPDSAPWDQWGDSESVDVLPDYRNAVIDYARDHGADADGLN
                    :* *:    *  :* *:      . *  *           *  :*  :.           

1522|gene|hwa       IAVDCGNGVGALATPPILDRMGAEVVTLNGAIDGHFPGRESKPTAESLTDLRTIVEN---
1384|gene|hut       IAVDAGNGVAALGTPEVLRRLGASVHTLHANVTGHFPGRPSKPTPENITDLTQYVRE---
10444|gene|hma      VAVDCGNGMASVATPQVLRELGADVLATEANVDGTFPGRESKPTPETLADFREFVAE---
1188|gene|hhi       VAVDCGNGMASVATPQVLRELGADVLATEANVDGTFPGRESKPTPETLADFREFVAE---
3514|gene|nph       VAVDCGNGMASHATPQVLRELGAEIVALNANVDGHFPGRESKPTAESLEALRTFVAD---
905|gene|nrc1       VAVDCGNGVAAVATPHVLRALGAHVVTLNANVDGHFPGRPSKPTPETVTDLREFVAT---
1418|gene|hla       IAVDCGNGMSAPATPTVLRELGAEVVTLNGNIDGHFPGRGSKPTPESLRDLRAFIAD---
18320|gene|hbo      IVVDCGNGMSALGTPQVLRELGARVVTLNGQVDGHFPGRESKPTPETLTDLRAFLADDET
                    :.**.***:.: .** :*  :** : :  . : * **** ****.*.:  :   :     

1522|gene|hwa       ---GQF-----------------DFGIGHDGDADRLVIVDRDGAVVHEDTVLAILAAHLV
1384|gene|hut       ---RDA----------------VDLGIAHDGDADRIVVVDEDGMIVHEDTILAVLSSYFV
10444|gene|hma      ---SDA-----------------DFGFGHDGDADRIVVVDADGDVIHEDTILAMLAEHYT
1188|gene|hhi       ---SDA-----------------DFGFGHDGDADRIVVVDADGDVIHEDTILAMLAEHYT
3514|gene|nph       ---GEF-----------------DLGIGHDGDADRIVVIDSSGDVVHEDTVLAILAKRYT
905|gene|nrc1       ---GDA-----------------AFGIAHDGDADRIVIVDGDGDIVHEDTIVAILADHYT
1418|gene|hla       ---ANEGVAAPGRPGAEIDAEGFAFGIGHDGDSDRIVIIDADGDVVHEDTVLALLAERYT
18320|gene|hbo      EPGGDF-----------------DFGIAHDGDSDRIVIVGPDGDVIHEDTVVAIVAEHFV
                        :                   :*:.****:**:*::. .* ::****::*:::   .

1522|gene|hwa       NVSDVADPVVVTTPNASARIDEHVQAADGRIERVQLGSLHEGIRDAEIAG--GD------
1384|gene|hut       EQADVDDPVVVTTPNVSGRVDEAVRTAGGRVERTALGLLHEGIADVLEAG--DDETTIAF
10444|gene|hma      RTADVSDPVVVTTPNASGRIDERVEAAGGRVERIHLGSLHVGIADVRADA--TDETEVVF
1188|gene|hhi       RTADVSDPVVVTTPNASGRIDERVEAAGGRVERIHLGSLHVGIADVRADA--TDETEVVF
3514|gene|nph       AQASEPSPVVVTTPNASGRIDEAVEAAGGSVERVRLGALHEGIADASAGE--GT---VVF
905|gene|nrc1       RTSDAADPVVVTTPNASGRIDDRVTAAGGRVERVQLGALHEGIAAARDDG--GD---VVF
1418|gene|hla       RESDAADPVVVTTPNASGRIDERVREAGGRVERVRLGALHEGIAAVRAESAPGDDTRVVF
18320|gene|hbo      RDSDADDPVVVTTPNASGRIDERVREAGGRVERVRLGALHEGIAAAREDG--GD---VVF
                      :.  .********.*.*:*: *  *.* :**  ** ** **  .              

1522|gene|hwa       ------------------VSSRVSHGSIHTQR-SADGLTLLLLQR---------------
1384|gene|hut       AGEPWKCIHPDLGIWTDGIASAGVLTRLIAAD-GLDSLLEPVTERPLEKKPVDCPEGAKA
10444|gene|hma      AAEPWKHIHTAFGGWIDGVASAAVLTRLFAGE-SVGDRRAVISERPYEKVSVECPDDAKA
1188|gene|hhi       AAEPWKHIHTAFGGWIDGVASAAVLTRLFAGE-SVGDRRAVISERPYEKVSVECPDDAKA
3514|gene|nph       AAEPWKHTHTRFGPWIDGVASAAVLGALVADR-GIEPLREPITERPYRKHNVDCPDEDKS
905|gene|nrc1       AAEPWKHIHTAFGGWIDGVASAAVLSRLVADAGGLAPLRDPVTERPYRKVSVDCPDEKKA
1418|gene|hla       AAEPWKHIHVGFGEWIDGVASAAVIARLVAES-GLDALREPITERPYRKVSIDCPDEAKP
18320|gene|hbo      AAEPWKHIHPGLGGWIDGVASAAVLTRLVAES-GLDALREPVTERPYRKVSVSCPDEKKQ
                                      ::*      : :   .       : :*               

1522|gene|hwa       ------------------------------------------------Y-----------
1384|gene|hut       DAMERLATALPEQFPDGTVSLEYGVRIELPDGSWFLVRPSGTEPYIRVYAESDDATALLE
10444|gene|hma      ETMERLESDLPDAFPEADVSTEYGVRLSFDDGSWTLVRPSGTEPYVRVYAESDDIDALVA
1188|gene|hhi       ETMEQLESDLPDAFPEADVSTEYGVRLSFDDGSWTLVRPSGTEPYVRVYAESDDIDALVA
3514|gene|nph       GAMSLLESRLPEQFPEATATTDHGVRLAFDDGSWVLVRPSGTEPYLRLYAESESVDALVD
905|gene|nrc1       AVMDAVADRLPDAHPDADVETEYGVRLAFADGSWALVRPSGTEPYVRVYAESSDVDELVD
1418|gene|hla       GVMDRLGSTLPDAFPDATVDTDHGVRLEFPDASWTLVRPSGTEPYVRIYAESDEVDELIA
18320|gene|hbo      AVMASLETTLPDAFPDADVDTEHGVRLELPDASWVLVRPSGTEPYVRVYAEADDVDALVG
                                                                    *           

1522|gene|hwa       ------------------
1384|gene|hut       EVRETVKEAVDAVA----
10444|gene|hma      DTTQAVRDAVAVVSAADA
1188|gene|hhi       DTTQAVRDAVAVVSAADA
3514|gene|nph       DVAAVVRSAVAEAD----
905|gene|nrc1       AVTDVVASTVSDV-----
1418|gene|hla       DVEAVVEDVVAAVADAE-
18320|gene|hbo      EASDVVEAAIESAD----