HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0257COG1183arCOG00671Phosphatidylserine synthaseCDP-diacylglycerol-serine O-phosphatidyltransferase

HOG Organism Gene ID Name Annotation
cHOG0257 nrc1 VNG0784 pssA CDP-diacylglycerol-serine O-phosphatidyltransferase
cHOG0257 hmu HMUK2392 Hmuk_2392 CDP-alcohol phosphatidyltransferase( EC:2.7.8.8 )
cHOG0257 hma RRNAC0788 pssA CDP-diacylglycerol-serine O phosphatidyltransferase
cHOG0257 hwa HQ2356A pssA CDP-diacylglycerol--serine O-phosphatidyltransferase (phosphatidylserine synthase)
cHOG0257 hla HLAC0607 Hlac_607 CDP-alcohol phosphatidyltransferase
cHOG0257 hbo HBOR20980 Hbor_20980 archaetidylserine synthase( EC:2.7.8.8 )
cHOG0257 hut HUTA0720 Huta_0720 CDP-alcohol phosphatidyltransferase
cHOG0257 hvo HVO_1143 HVO_1143 pssA CDP-diacylglycerol-serine O phosphatidyltransferase
cHOG0257 nph NP3230A pssA CDP-diacylglycerol--serine O-phosphatidyltransferase
cHOG0257 hhi 1434 pssA CDP-diacylglycerol-serine O phosphatidyltransferase
MUSCLE (3.6) multiple sequence alignment


10788|gene|hma      --MGFEVRRRLSVADTVTLFNAVVGFVAGAIAFTDPHLAARLILLAVIADAIDGIVARNG
1434|gene|hhi       --MGFEVRRRLSVADTVTLFNAVVGFVAGAIAFTDPHLAARLILLAVIADAIDGIVARNG
720|gene|hut        MQLRPRFLGRLGLADVVTVANVVVGFVAIIVAPLDPALAARLILLAAIADGLDGLIARSY
3230|gene|nph       --MQPRFLGQLGLADVVTVANAALGFIAAAVAVFDTELAARLILLAAIADGLDGVIARFR
784|gene|nrc1       --MQPRFVGRLGVADAVTTANAALGFLAVVTAPSNPRLAARIVLVAAIADGLDGVVARRL
607|gene|hla        --MYLRFVGRLGLADAVTVANAAVGFLAVVAAAVDPQLAARLILLAAVADGLDGVVARHR
2356|gene|hwa       --MEPRFVGRIGLADVVTIANAAVGFLATVAAIVDITLAVRLILLAAIADALDGVIARHR
20980|gene|hbo      --MKPRFVGKMGLADAVTVANAALGFFAAVAATVSITLAARLILLAAIADALDGVIARRR
                      :   .  .:.:**.**  *..:**.*   *  .  **.*::*:*.:**.:**::**  

10788|gene|hma      DSSAVGPLLDSVTDVVSFGATPSLFLYVLLTDA--YGGIESAHPAVFVGLALLASA-YVV
1434|gene|hhi       DSSAVGPLLDSVTDVVSFGATPSLFLYVLLTDA--YGGIESAHPAVFVGLALLASA-YVV
720|gene|hut        GSTPVGEFVDSLADAVSFGVAPAAVVVSLADETVHLDSVSSLLGSVEAAVVVGVPALFVT
3230|gene|nph       GGTPVGPILDSLADVASFGVAPAVLVYALA-----SGGEVTLDEPLAVA-AVVVAALYVA
784|gene|nrc1       GSTPAGKHLDSLADVASFGVAPACIVVAAT-----GNTWQ-AGAPVGIGALVVGAG-FVA
607|gene|hla        GSTDAGPYLDSLADVASFGVAPAALVAFVV-----LDARSFATDPILVAAGVGVAALFVS
2356|gene|hwa       GGTTVGEYLDSLADVASFGVAPASVVAVVI-----LDVW---HQSNWWGLAIGGTALFVA
20980|gene|hbo      GGTAVGEYLDALADVASFGVAPALLVAIAV-----REAW---SDPVRVGIALVGTALFVA
                    ..: .*  :*:::*..***.:*: .:                  .   .  :  .. :* 

10788|gene|hma      CSIVRTAFYSTYFDSPDERPGMPNTLGSIIIATAYLSGITNPLVLSVGALGLSLAMIAPF
1434|gene|hhi       CSIVRTAFYSTYFDSPDERPGMPNTLGSIIIATAYLSGVTNPLVLSVGALGLSLAMIAPF
720|gene|hut        AAVIRLAMYTAYDIEERVTEGVQSTLAATVLAAAVLAIDLPAWWLVGAVGVLAYLMITRI
3230|gene|nph       MAVVRLGFYLLEDDGAPETVGVQTTLAATVLSVLHLAGVTDPAVFVAATAAFAYLMVASI
784|gene|nrc1       SAVVRLGLYTAYDTGHEHTEGVQTTLAATLLAAGVLAGVEQPTVIVGAAGVLAVLMVSTI
607|gene|hla        MAVARLGMYTAYDADERETVGVPTTLAATVLAAAVIAGYTAPALLIAATAAFALLMGSTV
2356|gene|hwa       AAVTRLGLYTAYDSASNETEGVQTTLAATILAASVLAGFTNPAILSALVVILTVLMLAPI
20980|gene|hbo      AAVTRLGLYTAYDSDLAETEGVQTTLAATILSAGVLAGFSDPIVLVPLVYLLAVLMVTTI
                     :: * .:*           *: .**.: :::.  ::    .  :   .  ::  * : .

10788|gene|hma      DYPKPGPKHAVPMGVVQAVAVVAPAA----------LFRAGPRAMLAIALLFFALGPWFY
1434|gene|hhi       DYPKPGPKHAIPMGVVQAVAVVAPAA----------FFRAGPRAMLAISLLFFALGPWVY
720|gene|hut        PYPDLRTRDALSMGVVQAGAVLVPGI----------ASRVFPRLLLTVALAYLLLAPRFY
3230|gene|nph       TYPELYARDALILGGLQACVVLFPTA----------FGRAFPRVLLVFALGYLLLAPVAY
784|gene|nrc1       EYPDLLVRDALAMGVVQAGAVVAPAA----------LAGAFPKALFGWAGAYLVFAPRFY
607|gene|hla        TYPDLHAQDALVMGVVQAAVILTPVGHMVTSLLPAWIGEGFAFALLFLSVGYLILGPRFY
2356|gene|hwa       TYPDLHAQDAIVMGSVQTAAIGLTGSF--GHHIAGTLGEGFAFGLLFLSLAYLVFGPQFY
20980|gene|hbo      TYPDLHAQDALVMGIVQALAILLSGPY--GRRLVGDLGRGFAFGLLFLALAYLFFGPMFY
                     **.   . *: :* :*: .:  .                 .  ::  :  :: :.*  *

10788|gene|hma      P-------------------------GE-
1434|gene|hhi       S-------------------------GE-
720|gene|hut        P------------------------RVET
3230|gene|nph       W-------------------RSTEGKRS-
784|gene|nrc1       W------------------------RAA-
607|gene|hla        WGDGIRSPTDVEDAKDATDADAVEDRGA-
2356|gene|hwa       W------------------------RRE-
20980|gene|hbo      W------------------------RRD-