HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0256COG1093KOG2916arCOG04107Translation initiation factor 2 alpha subunit (eIF-2alpha)translation initiation factor eIF-2 subunit alpha

HOG Organism Gene ID Name Annotation
cHOG0256 nrc1 VNG0549 eif2a translation initiation factor eIF-2 subunit alpha
cHOG0256 hmu HMUK2880 Hmuk_2880 translation initiation factor 2, alpha subunit
cHOG0256 hma RRNAC3512 eif2A translation initiation factor IF-2 subunit alpha
cHOG0256 hwa HQ1255A tif2a translation initiation factor IF-2 subunit alpha
cHOG0256 hla HLAC1009 Hlac_1009 translation initiation factor 2, alpha subunit
cHOG0256 hbo HBOR25180 Hbor_25180 translation initiation factor 2 subunit alpha (aeIF-2a)
cHOG0256 hut HUTA2790 Huta_2790 translation initiation factor 2, alpha subunit
cHOG0256 hvo HVO_0699 HVO_0699 translation initiation factor 2 subunit alpha
cHOG0256 nph NP1618A tif2a translation initiation factor IF-2 subunit alpha
cHOG0256 hhi 730 eif2A translation initiation factor IF-2 subunit alpha
MUSCLE (3.6) multiple sequence alignment


1009|gene|hla       MKYSGWPEPGELVVGDVDEIADFGVFVDLDEYEDKRGLCHISEVASGWIKNVRDHVREGQ
1255|gene|hwa       MKYTGWPEPGEPVVGEVDEIADFGVFVDLEEYADKRGLCHISEVASGWIKNVRDHVREGQ
25180|gene|hbo      MKYSGWPDSGELVVGKVDEITDFGVFVDLEEYEDTRGLCHISEVASGWIKNVRDHVREGQ
2790|gene|hut       MKFSGWPEPGELVVGRVDEIEDFGVFVDLLEYEDKRGLAHISEVASGWIKNVRDHVNEGQ
13512|gene|hma      MKYSGWPEPGELVVGKIDEIEDFGVFVDLDEYEGKRGLCHISEVASGWIKNVRDHVNEGQ
730|gene|hhi        MKYSGWPEPGELVVGKIDEIEDFGVFVDLDEYEGKRGLCHISEVASGWIKNVRDHVNEGQ
549|gene|nrc1       MKYEGWPDEGELVVGKVDDIEDFGVFVDLEQYQDKRGLVHVSEVASGWIKNVRDHVNEDQ
1618|gene|nph       MKYSGWPTPGELVVGRVDEIEDFGVFVDLEEYEEKRGLVHVSEVASGWIKNVRDHVNEDQ
                    **: ***  ** *** :*:* ******** :*  .*** *:***************.*.*

1009|gene|hla       TVVAKVLDVDESANQIDLSIKDVNEHQRKDKIQDWKNSQKADNWMLIALGEDVDDDRYTA
1255|gene|hwa       TVVAKVLDVDESAKQIDLSIKDVNEHQRKETIQEWKNEQKADNWMEIAFGEDIDDERYTA
25180|gene|hbo      TVVAKVLDVDTGSQQIDLSIKDVNEHQRKEKIQEWKNEQKADKWMSLAFGEDVTDDEYSE
2790|gene|hut       TVVAKVLDVDKDAQQIDLSIKDVNDHQRKDTIQEWKNEQKADNWMTIAFGEDLEDDRYAD
13512|gene|hma      TVVAKVLDVDESAQQIDLSIKDVNDHQRKEKIQEWKNEQKADNWMELAFGEDLDDETYAA
730|gene|hhi        TVVAKVLDVDESAQQIDLSIKDVNDHQRKEKIQEWKNEQKADNWMELAFGEDLDDETYAA
549|gene|nrc1       TVVAKVLGVDESAQQIDLSLKDVNDHQHSDTIQEWKNEQKADKWLTLAFGEDMADDQFRR
1618|gene|nph       MVVCKVLEVDESAQQVDLSIKDVNDHQRSEKVQEWKNEQKADKWMELAFGEDVDDGTFRR
                     **.*** ** .::*:***:****:**..:.:*:***.****:*: :*:***: *  :  

1009|gene|hla       VANALLVEFDSLYDAFEAAAISGEEALEEIDIDDDALDAIVTAARDNVSVPYVDVTGYVD
1255|gene|hwa       VANALLAEFESLYTSFEQAAIHGTEALDAVELDNEEIAAIVETARRNVSVPYVTVTGYVD
25180|gene|hbo      IANAVLAEYETLYDGFEQAAIHGVSALEDVDLDEDEVEAIVDTARQNVSVPYVNVTGYID
2790|gene|hut       IAEELIAGFGSMYDGFEQAAIHGTEPLEETDLAEDEVDAIVEAARENVSVPYVNVTGYVD
13512|gene|hma      IANELLAEFGSMYDGFESAAIHGKDALEDVDLSEEEIDAIVQTARNNVSVPYVQVTGYVD
730|gene|hhi        IANELLAEFGSMYDGFESAAIHGNDALEDVDLSEEEIDAIVQTARNNVSVPYVQVTGYVD
549|gene|nrc1       IANGLLADFGSLYDGFEQAAIHGHEALADTALEDDEIDAIVETARDNVSVPYVTVTGYVS
1618|gene|nph       IANELIDAHGSLYAGFEQAAIHGPEALDATDLDDDELDAIVETARENVSVPYVTVTGYVD
                    :*: ::  . ::* .** *** * ..*    : :: : *** :** ******* ****:.

1009|gene|hla       LESTAPNGVDDVKAALEAAEGNGE-VPDGVDLEVGYVGSPEYRIKVRAPNYKTAEDQLEA
1255|gene|hwa       LECPVGDGVDKVQSALQAVEGDSQTIGDEIDLDVTYVGAPEYRIRVEAPDYKTAEGALEA
25180|gene|hbo      IRCPTGDGVDDIKEALKAAEGD-D-VPEEIQLEVTYVGAPEYRIKVRAPDYKTAETALED
2790|gene|hut       LTCPESDGVDAIKEAMQAAEGNGE-VPEEIELDVTYVGAPEYRIEVQAPDYKTAESQLEA
13512|gene|hma      LSCPESDGVDIIKEALQAAEGNGE-VPDEIELEVTYVGSPEYRIQVQAPDYKTAEDALEE
730|gene|hhi        LSCPESDGVDVIKEALQAAEGNGE-VPNEIELEVTYVGSPEYRIQVQAPDYKTAEDALEE
549|gene|nrc1       LQSPDGDGVDTIKDALQAAEGNGE-VPDEVDLDVTYVGAPEYRLRVQAPNYKTAESALEA
1618|gene|nph       LEAPGGDGVEDVREALQAAEGNGE-VPEEVDLDVTYVGAPEYRIRVQAPNYKTAESELEA
                    : ..  :**: :. *::*.**: : : : ::*:* ***:****: * **:*****  ** 

1009|gene|hla       AAARAREAIEAAGGSGGFHRDRHEDDE-
1255|gene|hwa       AADRAKTAVTD-GGTVEYHRERRSDEE-
25180|gene|hbo      AAARAKEVIESRGGTGEFHRERHEDDE-
2790|gene|hut       SADRATAAIEERGGSAEYHRERTTDEE-
13512|gene|hma      SADRAAKVVEQHGGSGQFHRERSEDDE-
730|gene|hhi        SADRAAKVVEQHGGSGQFHRERSEDDE-
549|gene|nrc1       AGDRAVDSVTAHDGSGAFHRERQLDDDA
1618|gene|nph       SAERASDAIEAVGGTAEFHRERRTDEE-
                    :. **   :   .*:  :**:*  *::