HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0254COG0367KOG0573 KOG0571arCOG00071Asparagine synthase (glutamine-hydrolyzing)asparagine synthetase

HOG Organism Gene ID Name Annotation
cHOG0254 nrc1 VNG0867 asnA asparagine synthetase
cHOG0254 hmu HMUK1987 Hmuk_1987 asparagine synthase( EC:6.3.5.4 )
cHOG0254 hma RRNAC1359 asnB asparagine synthetase
cHOG0254 hwa HQ1691A asnB asparagine synthase (glutamine-hydrolyzing)
cHOG0254 hla HLAC0611 Hlac_611 asparagine synthase
cHOG0254 hbo HBOR22320 Hbor_22320 asparagine synthase (glutamine-hydrolyzing)( EC:6.3.5.4 )
cHOG0254 hut HUTA0732 Huta_0732 asparagine synthase
cHOG0254 hvo HVO_1050 HVO_1050 asnA asparagine synthetase
cHOG0254 nph NP2978A asn asparagine synthase (glutamine-hydrolyzing)
cHOG0254 hhi 1949 asnB asparagine synthetase
MUSCLE (3.6) multiple sequence alignment


1691|gene|hwa       MMSGPPTNPPGQPQSSTKNESILRGASTETVHDAISDTIALAGTGGFAGYI-D------G
611|gene|hla        --------------MTTPSSSDLRGASPDRICDALRGGDPLPGGRGFAGLLRDPPNREGP
2978|gene|nph       ----------------------MQGTAVEAVRECLETKAPLAGTCGFAGEL-D------G
22320|gene|hbo      ---------------------MLRGADETTVRAAIESSDPLSGTAGFAGEL-N------G
867|gene|nrc1       ----------------------MRGAAPDAVLDAVQSGDPLPGTGGFAGELPD------G
732|gene|hut        ----------MVSVPSDPSPSRLQGADPDVVRAAIEAGDPLPGTRGFAGRL-D------G
11359|gene|hma      ----------------------MQGADADTVADALASDDALPGAGGFAGEL-D------G
1949|gene|hhi       ----------------------MQGADPDTVADALDSGDALPGSGGFAGEL-D------G
                                          :.*:    :  .:    .*.*  **** : :       

1691|gene|hwa       MLVRDVLGRQPIFLETA----TQSSHGVMPD-WAFNPLSLEAPATLPPGAVYDPSQRAIS
611|gene|hla        VLVRDVLGREPLFVERGGADPASGGDPTDSGIWSFDRTDLDDPEPVPAGTVASSAGA---
2978|gene|nph       GVVRDVLGRYPAFTEPE-----------TPSAWSPDPTDLSEPEPVPAGCIRTADGD---
22320|gene|hbo      TLVRDVLGRQPLFSERN-----------DPETWAFDRRELADPVRVPAGTRRTDDGD---
867|gene|nrc1       RLARDVLGRRLCYV--------------DGDEWSHDPRDLAAPTLLPAGHVRAPGATGSG
732|gene|hut        RLVRDVLGRYPLFVERD-----------NPDSWSFEPGKLADPVPVPAGTVQDGETV---
11359|gene|hma      TLVRDVLGRYPLFVERA----VSDEARLDPGQWSHDPTALADPRSFPAGHIRNESGT---
1949|gene|hhi       TLLRDVLGRYPLFVERT----VSDGEPLDPGQWSRDPTALADPRSFPAGHIRDDNGT---
                     : ******   :                   *: :   *  *  .*.*           

1691|gene|hwa       DDDIIYMDDNTSIDDANSDQQGNTVDVDVEIRHLDIARYWSLPKPPVTTDNDEAYRRVKK
611|gene|hla        E------------------------------------RVWSLPDEEPV-DAESGQAAVDE
2978|gene|nph       R------------------------------------QVWSLPDPEPVADTDRAVSAVAD
22320|gene|hbo      K------------------------------------RVWSLPTPAPETDREAALANVES
867|gene|nrc1       R------------------------------------PVWSLPEPAPTGD--EPVERVRD
732|gene|hut        T------------------------------------QWWSLPQPSPRSGR-RAVDAVRS
11359|gene|hma      Q------------------------------------QRWSLPSLDPFGDRETAIETVGE
1949|gene|hhi       R------------------------------------QRWSLPSPDPFSDRETAINRVRE
                                                           ****      .       * .

1691|gene|hwa       AIITQTQKQTTDNSNKSTAIAFSGGIDSAVVAAGRPNAPCYVAGFDGCHDITAAQEALSA
611|gene|hla        ALGAVLGEIKTEANRNDLAVAFSGGIDSGVVAAAVPDAPCYVAGFEGCHDIEAAREAATA
2978|gene|nph       AIDAAIDSVD-----GAPAVAFSGGIDSSLLAAGL-DGPLYVGGFEGSHDITAARSAADL
22320|gene|hbo      AVHGAVQNVES----EGLAVAFSGGVDSAVVAAGVPDAPCYVAGFEGSHDVAAARDAADA
867|gene|nrc1       AVAGALGGVPAG---DDLAVAFSGGVDSALAAAAL-DAPLYVVGYADSSDIAAARESAAA
732|gene|hut        ALDTALDAVET----DGLAVAFSGGVDSALLAARL-DVPLYVAGFPESHDVRAAREAAAL
11359|gene|hma      TVETSIDAVDT----DSLAIAFSGGVDSALLAARL-DAPLYVAGFPDSHDIEAARSAAEL
1949|gene|hhi       AVETSIDAVDT----DSLAIAFSGGVDSALLAARL-DAPLYVAGFPDSHDVEAARSAADL
                    ::                *:*****:**.: **   : * ** *:  . *: **..:   

1691|gene|hwa       MDRNADLHVIEISHTDIIEAIPQLVSAIGRTNPMDLAITVPLFIVARRVAADGFDRLALG
611|gene|hla        ME--LDLRVVEITHDDLVRAVGAVAAATGRRNPMDVAIAVPLYLAAEAAATDGIDRLAVG
2978|gene|nph       LD--RRVRVVEFTHADLERATPTVVEATGRSNPMDVQLALSLYLIAEAVAEDGHDRLALG
22320|gene|hbo      MD--RELHVVELTHDALREAVPELVSVLGRTNPMDIQIVLPLYLVAKQVAADGFDRLAVG
867|gene|nrc1       MGRADDLRVHEVTLADIEAAVPTVARAIGRTNAMAVQIALPLFLVAARAAADGYSRLVVG
732|gene|hut        LD--ADLRVVELDHALLERTVPDVVAATGRTNAMDVEIAVPLYLVASRAATDGFDRLAVG
11359|gene|hma      LG--TEVRVVELTHDAIERAVPEIARATARTNAMDVQIALPLYLVAERVAGDGFDRLALG
1949|gene|hhi       LG--TEVRVVELTHEAIERAVPEIARATGRTNAMAVQIALPLYLAAERVAADGFDRLALG
                    :     :.* *.    :  :   :. . .* *.* : :.:.*:: *  .* ** .**.:*

1691|gene|hwa       QGADELFGGYAKVQKAPTDPRVNATTIRGAQRELLNTVPKQAERDMLAIRAGGVEPITPF
611|gene|hla        QGADELFGGYSKVVNPAGDDRVAAETVRGARTETVRTLPEQLDRDVLALRAAGVEPVAPL
2978|gene|nph       QGADELFGGYAKVAKAPADPRVDADTVRGARREVVGSLPSQLERDVLAVRAAGIEPVTPL
22320|gene|hbo      QGADELFGGYAKVEKAPDDPRVEADTVRGAATEMVRTLPEQLERDVLTLRAAGVEPVAPL
867|gene|nrc1       QGADELFGGYAKVAKAPTDPRTDADTVRGARRETVQSLPAQLERDLRALRAAGVEPVTPL
732|gene|hut        QGADELFGGYAKVANAPEHSRVGADTVRGAHREGLETLPDQLERDILAIRAAGVEPVAPL
11359|gene|hma      QGADELFGGYAKVAKAPEDPRVEADTVRGAQREVIASLPDQLERDVLALRAAGVEPVTPL
1949|gene|hhi       QGADELFGGYAKVAKAPEDPRVEADTVRGAQREVIASLPDQLERDVLALRAAGVEPVTPL
                    **********:** :..   *. * *:***  * : ::* * :**: ::**.*:**::*:

1691|gene|hwa       LHDSIVESALTLPESLLVCG-DQRKIALRMAA----DGIVPESVRTASKKAVQYGTYVSR
611|gene|hla        LDDRLVAAALALPGELLASD-DERKVALRRAA----TDRVPESVRTADKKAVQYGTYVSR
2978|gene|nph       LCDGVVSAALRLPAELLVAG-DTRKVALRRAAETVPDGGVPADIRDREKKALQYGSLLAR
22320|gene|hbo      LHDDVVSAALPLPGELLVAD-SRRKVALREVA----GELVPDSVASADKKAVQYGTYAAR
867|gene|nrc1       LHDDVVRAALALPGEWLVSG-DTRKRALREAA----RSWLPDAVADRDKKAVQYGSLVAR
732|gene|hut        LDDHVVEAALSLPGRLLVSPRGDRKYAFRLAT----RAWLPDRIAFREKKALQYGSLVAR
11359|gene|hma      LHDRVIGAALRLDGDLLVDG-ETRKVALRAAA----RESLPDEIADRDKKAAQYGSLAAR
1949|gene|hhi       LHDRVVEAALRLDGDLLVDG-ETRKVALRAAA----RGSLPDEIANRDKKAAQYGSLAAR
                    * * :: :** *    *.     ** *:* .:       :*  :   .*** ***:  :*

1691|gene|hwa       ELDRLARQDGFKRRMDHHIQKYVHSLIK--
611|gene|hla        EIDRLARRAGFKRRMDDHVGQYLDALLAEQ
2978|gene|nph       EFDRLARQAGFKRRMDNHLGKYIEDRCQDA
22320|gene|hbo      ELDRLARQAGYKRRMENHVEQYVQSLIEE-
867|gene|nrc1       EVDRLARQAGFKRRMDDHVTQYVEARIEE-
732|gene|hut        ELDRLARQAGFKRRMDNHVTQYVESLKG--
11359|gene|hma      ELDRLARQAGYKRRMDDHVTQYVESLVE--
1949|gene|hhi       ELDRLARQAGYKRRMDDHVTQYVESLVE--
                    *.*****. *:****: *: :*: