HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0251COG0137KOG1706arCOG00112Argininosuccinate synthaseargininosuccinate synthetase

HOG Organism Gene ID Name Annotation
cHOG0251 nrc1 VNG2437 argG argininosuccinate synthetase
cHOG0251 hmu HMUK0769 Hmuk_0769 argininosuccinate synthase( EC:6.3.4.5 )
cHOG0251 hma RRNAC2683 argG argininosuccinate synthase
cHOG0251 hwa HQ3711A argG argininosuccinate synthase
cHOG0251 hla HLAC2619 Hlac_2619 argininosuccinate synthase
cHOG0251 hla HLAC2757b Hlac_2757 hypothetical protein
cHOG0251 hbo HBOR01700 Hbor_01700 argininosuccinate synthase( EC:6.3.4.5 )
cHOG0251 hut HUTA1505 Huta_1505 argininosuccinate synthase
cHOG0251 hvo HVO_0049 HVO_0049 argG argininosuccinate synthase
cHOG0251 nph NP5252A argG argininosuccinate synthase
cHOG0251 hhi 3086 argG argininosuccinate synthase
MUSCLE (3.6) multiple sequence alignment


2757|hp|hla         --------------------------------------------MPYYSF----------
2619|gene|hla       ------MATVALAFSGGLDTTVCVPLLKEEYGYDEVIGVNVDVGQPTEEFDEAEETADAL
2437|gene|nrc1      ----MPSGTVALAFSGGLDTTVCVPLLKEEYGYDDVIGVTVDVGQPDAEFAAARETAAAL
1505|gene|hut       MTQQDGNGTVALAFSGGLDTTVCVPLLKEEYGYDDVIGVTVDVGQPDYEFDEAEETAEAL
12683|gene|hma      --MPEGNGTVALAFSGGLDTTVCVSLLKEEYGYDEVIGVTVDVGQPDYEFEEAEETAEAL
3086|gene|hhi       --MPEGNGTVALAFSGGLDTTVCVSLLKEEYGYDEVIGVTVDVGQPDYEFEEAEETAEAL
5252|gene|nph       ---MSDKNRVALAFSGGLDTTVCVPLLEEEYGYDEVIGVTVDVGQPEAEFKEAEETAEAL
3711|gene|hwa       ------MTRVALAFSGGLDTTVCVSLLKEEYGYDEVIGVTVDVGQPATEFEEAQATADAH
1700|gene|hbo       ------MTSVALAFSGGLDTTVCVSLLQEEYGYDEVVGVTVDVGQPESEFEEAKETADAH
                                                                 *  .*          

2757|hp|hla         ------MESDPLFREVQRFRQPWIWALLGGIALLMLVLGPILWGGLAIVV---GIAGLIY
2619|gene|hla       GLDLHVVDAKEEFADL-CYDAVKTNATYQGYPLGTALARPVIAEAILGVAEEQGCDAIAH
2437|gene|nrc1      GVEHHVVDATAEFAAL-CFDAVRANATYQGYPLGTALARPVIADAILSVAEAEGCAALAH
1505|gene|hut       GLDHYVVDAREAFADL-CLQAVEANADYQGYPLGTALARPVIAEGIADVAREQGCSALAH
12683|gene|hma      GVEQHVVDATEEFADL-CMEAVKANADYQGYPLGTALARPVIAKAILSVAEDEGCSAVAH
3086|gene|hhi       GVEQYVVDATEEFADL-CMEAVKANADYQGYPLGTALARPVIAKAILSVAEEEGCSAVAH
5252|gene|nph       DLEHHVVDAKPEFAEL-CFDAVRANASYQGYPLGTALARPVIAEAILEVAKEEGCSGVAH
3711|gene|hwa       GIDLHVVDATAEFVDL-CFDSVRANATYQGYPLGTALARPIIAESIVSVAKAENCDALAH
1700|gene|hbo       GLDIHVVDAKDEFAEL-CFDSVRANATYQGYPLGTALARPVIAEAILEVAQEEGCDALAH
                          :::   *  :        .*   * .*   :  *::  .:  *.   .  .: :

2757|hp|hla         S--------LRLQTEVRTDGI----------YFRMWPLH----------------WSFRQ
2619|gene|hla       GCTGKGNDQLRFEAVWRGSDLEVIAPVRELGLTREWEIDYAAEKDLPVEAGDGGVWSIDE
2437|gene|nrc1      GCTGKGNDQLRFEAVWRASDHDVCAPVRELGLTREWEIEYAAERDLPVEAGNEGEWSIDT
1505|gene|hut       GCTGKGNDQLRFEAVWRDTDMDVIAPIRELGLTREWENEYAEEKGLPVEGGAGGRYSIDT
12683|gene|hma      GCTGKGNDQLRFESVWRDSDLDVIAPVRELGLTREWENEYAAEKGLPVEGGDGGRYSIDT
3086|gene|hhi       GCTGKGNDQLRFEAVWRDSDLDVIAPVRELGLTREWENEYAAEKGLPVEGGDGGRYSIDT
5252|gene|nph       GSTGKGNDQLRFEAVWRDSDLEVIAPVRELGLTRTFEQEYAEERGLPIEGGDEGKYSIDT
3711|gene|hwa       GCTGKGNDQLRFEAVWRNSDLTVIAPIRELELTREWEQEYAAEHNLPVQAGNDGVWSIDT
1700|gene|hbo       GCTGKGNDQLRFEAVWRASDLDVIAPVREMGLTREWEKQYADEKNLPVQAGNDGVWSIDT
                    .        **:::  *  .             * :                   :*:  

2757|hp|hla         IPWS---ETEHYEAKQYSPIREFGGW----------------------------------
2619|gene|hla       NIWSRAVEGGKLEDPSYEPPEDIYEWTAGPE--GET-TIEVTFEEGVPVAIDGEAMDPVP
2437|gene|nrc1      NLWSRSVEGGHLEEPDYQPPADIYAWTDAPS--GETGTVDITFEAGVPVAVDGTAMEPVA
1505|gene|hut       NLWSRSIEGSELEDPATIPEDDIYLWTENPS-GKEAELVEITFEDGTAVAVDGEELGSVE
12683|gene|hma      NLWSRSIEGSELEDPSTIPADDIYKWTDNPS-DKDAELVEVEFEDGVPVAVDGEELGGVE
3086|gene|hhi       NLWSRSIEGSELEDPSTIPSDDIYKWTDNPS-DKDAELVEVAFEEGVPVAVDGEELDGVK
5252|gene|nph       NLWSRSIEGSELEEPGYVPPEDIYEWTTAPT--AETLEVEVGFEDGYPVSLDGEKLEPVE
3711|gene|hwa       NLWSRSIEGGKLEDPNYTPPEDVYEWTADPATTTETELITIGFESGYPVSINDNAHDPVE
1700|gene|hbo       NLWSRSVEGGDLEKPGHVPSEDIYEWTEQPG--SETECIEITFEEGYPVALDGEEMEPVE
                      **   *    *     *  :.  *                                  

2757|hp|hla         ------------GIR---------------------------------------------
2619|gene|hla       LIQYLNKYAGGYGIGRTDVMEDRMLGLKVRENYEHPAATVLLTAHQALEDLVLTKNERSF
2437|gene|nrc1      LIEALNDRAGSYGVGRTDMLEDRMLGLKVRENYEHPAATTLLAAHKALEGLVLTKAERDF
1505|gene|hut       LIEELNERAGAHGIGRTDMMEDRMLGLKVRENYEHPAATVLLTAHEALEGLVLTAEERQF
12683|gene|hma      LIEQLNKQAGAHGIGRTDMMEDRMLGLKVRENYEHPAATVLLTAHEALEGLVLTQEERQF
3086|gene|hhi       LIEQLNEQAGAHGIGRTDMMEDRMLGLKVRENYEHPAATVLLTAHEALEGLVLTQEERQF
5252|gene|nph       LIETLNDLAGDYGVGRTDIMEDRMLGLKVRENYEHPAATVLLNAHQALEDLVLTKEERAF
3711|gene|hwa       LVETLNEVAGEHGVGRTDMMEDRMLGLKVRENYEHPAATTLLNAHKALEGLVLTKDERDF
1700|gene|hbo       LIETLNELAGQYGVGRTDMMEDRMLGLKVRENYEHPAATTLLNAHESLEGLVLTKDERDF
                                *:                                              

2757|hp|hla         -------WAP-------------------GKIAYNVSGNQGVWIEQTNGRSILLGSQHA-
2619|gene|hla       KKGIEQEWSEKAYQGLVFAPVVDALDAFVDETQDVVTGTATVKVSGGNCRVVARDSEYAV
2437|gene|nrc1      TAAVSQQWAQKAYEGVVEHPLMDALNGYLDETQSAVSGTVTIAFEGGRARPIARESEHAV
1505|gene|hut       KTTIDQRWSEKAYEGLIDAPLMKDLEGFIDETQTRVTGTVTVKLEGGHTRAVSRESDYAV
12683|gene|hma      KAQVDQEWSQKAYQGLVDAPLTGALEAFIDDTNERVTGTVTVKLEGGHCRPVSRESDYAV
3086|gene|hhi       KAQVDQEWSQKAYQGLVDAPLTGALEAFIDDTNERVTGTVTVKLEGGHCRPVSRESDYAV
5252|gene|nph       KKQVDHEWSEKGYQGLVNAPLVDALEGFIDETQDRVTGTVTIRFEGGQARPVGRESPYAV
3711|gene|hwa       KRHIDSEWAQKGYEGLVDHPLMDALEGFIDATQQRVTGTVTIKFEGGQARPVGRESAAAA
1700|gene|hbo       KTTVDNEWAQKGYEGLVEAPLMAALDGFIEQTQTKVTGTVTIKFEGGQARPVGRESEYAA
                           *:                          *:*.  : ..  . * :   *  * 

2757|hp|hla         --------------------------------EEFSSAIDEATQ----------------
2619|gene|hla       YSEEMASFNTEDV-AGIAQEDATGVAKYHGLQERLANDVKAGVEKPELATDGSGAADEID
2437|gene|nrc1      YSADAASFNTETV-AGIEQADATGVAKYHGFQSRLANAAFDGNK----------------
1505|gene|hut       YSESAASFNEEDVTGGITQDDATGVAKYHGFQSRLAKRVTESLDEE--------------
12683|gene|hma      YSESAASFNEEDVSGGITQQDATGVAKYHGFQSRLANKILDDAKKGAAVTDGSGDH--AA
3086|gene|hhi       YSESAASFNEEDVSGGITQQDATGVAKYHGFQSRLANKILDDAKKGAAVTDGSGDQSDAA
5252|gene|nph       YSAEAASFNTEDVTGGIEQSDATGVAKYHGFQERLANRVIDAADEE--------------
3711|gene|hwa       YSADAASFNTSSI-GEITQQDATGIAKYHGYQGRIANAATETDTK---------------
1700|gene|hbo       YSESAASFNTETV-DGITQEDATGVAKYHGFQTRIANAAFESAQKEAPELATDGGVSNDG
                                                      ::.                       

2757|hp|hla         ------
2619|gene|hla       DEN---
2437|gene|nrc1      ------
1505|gene|hut       ------
12683|gene|hma      SEDTEE
3086|gene|hhi       TEDTEE
5252|gene|nph       ------
3711|gene|hwa       ------
1700|gene|hbo       Q-----