HOG Organism Gene ID Name Annotation
aHOG2479 hbo HBOR16090 Hbor_16090 hypothetical protein
aHOG2479 hut HUTA1100 Huta_1100 conserved hypothetical protein
aHOG2479 hma Hma_11162 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


16090|hp|hbo      ----MNRRTFLVTAGVGVTLSLSGCLDGS----GGAGAPTDGFEETN-------GDGGM-
1100|chp|hut      MRRHVTRRAVLASVGA---TSLAGCLGGT-----GNDEPRSAADKES----TDRSESAES
11162|hp|hma      --MRISRRRFLATVGAGVTLGGAGCVGDEGATAGGGSEPDSSTGTSTASMATDRNDGSE-
                      :.** .*.:.*.    . :**:..      * . * ..    .       .:..  

16090|hp|hbo      -SPVGSGNVSLP-----VPKDDLNRGASKDAIPAIVSPKFGSDWSDVDATLDDGELVIGV
1100|chp|hut      GPPTAEQRHPLPMEPARLKNRAVSGGPPKDGIPSIDDPTFEPADAATEK-LEPGDPVFGI
11162|hp|hma      -PPTTDSRLHLDYEIGTLEENIVSGGVPKDGIPAIDDPTF--ADTPPDG-LAPDDPVFGV
                   .*. . .  *      : :  :. * .**.**:* .*.*    :  :  *  .: *:*:

16090|hp|hbo      ELDGEARAYPLAVLNWHEIVNDQFD-RPVLVTYCPLCGSAVVAERTVAGDTRTFGVSGYL
1100|chp|hut      ATGETAKAYPQRILVHHEICNDSIDGRPIAVTYCPLTGTAMGFER---GET-TFGVSGRL
11162|hp|hma      VRNGEAKAYPQYILVHHEIVNDTIAGDPVAVTYCPLTGTAQGFER---GPV-EFGVSGRL
                    .  *.***  :* .*** ** :   *: ****** *:*   **   * .  ***** *

16090|hp|hbo      WQSDLVMYDRESESLWSQVLATAIRGSLTGS----QLDLLPSTTTSWGEWRESHPDTSVL
1100|chp|hut      ANNNLIMYDRATETWWPQVLATAIPGPWNDDPAIRSLREFRVVWTTWERWTAVHPDTRAL
11162|hp|hma      VNSNLTMYDRGTDSWWPQMLATAITGPLTGE----SLREFRVIWTTWSRWSSAYPETRIL
                   :.:* **** ::: *.*:***** *. ...    .*  :    *:*  *   :*:*  *

16090|hp|hbo      LPPPVSDTVTGRQTRDYDRNPYLGYETSSRVGIGFNDD----------VDDRLHPKARVI
1100|chp|hut      ------STKTG-FAREYGLDPYGSYNPRT----GYYSPESDPRFPAFSGDRQLARKRVVI
11162|hp|hma      ------TEDTG-FSRRYGVDPYGQYNEKR----GYYSS-TRTLFEPLHSDSRAHPKAVVI
                           **  :* *. :**  *:       *: .            * .   *  **

16090|hp|hbo      GVAHGDKAVAYPLSTLSETPVVNDEVGGLPVVAAATVDGTLVAYDRRVDGSAITFDRESG
1100|chp|hut      GARSADGAAAFLKDTLRAEKLINGELGGSPVVA---------VYEPTLDTGYVFGNPEDE
11162|hp|hma      GTRTETGGLAFDKETLLRQRVLTGRIDDTPYVA---------VADTNLASGYVYANPESM
                  *.     . *:  .**    ::.. :.. * **         . :  :  . :  : *. 

16090|hp|hbo      TDVLTGDGSRWDLHTGRALDGPHEGAALARANDRSLMF---WFAWADFFPETTIYSTE
1100|chp|hut      QFEYR-DGQLVD-EAGETYAPS------SPPGERILAFDAMWFAWSGFYPETTLYA--
11162|hp|hma      SVAASDDGYMID---GTAYDAD------SLPLDRTLSFDAMWFAWAGFYPESGYVN--
                        **   *   * :          : . :* * *   ****:.*:**: