HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0247COG0237KOG3220arCOG01045Dephospho-CoA kinasehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0247 nrc1 VNG2452 vng2452 no entry
cHOG0247 hmu HMUK1265 Hmuk_1265 adenylate kinase( EC:2.7.1.24 )
cHOG0247 hma RRNAC3145 adk adenylate kinase
cHOG0247 hwa HQ3047A coaE dephospho-CoA kinase
cHOG0247 hla HLAC1857 Hlac_1857 dephospho-CoA kinase
cHOG0247 hbo HBOR00950 Hbor_00950 dephospho-CoA kinase( EC:2.7.1.24 )
cHOG0247 hut HUTA2091 Huta_2091 adenylate kinase
cHOG0247 hvo HVO_0128 HVO_0128 adenylate kinase
cHOG0247 nph NP0870A coaE dephospho-CoA kinase
cHOG0247 hhi 411 adk1 adenylate kinase
MUSCLE (3.6) multiple sequence alignment


2452|chp|nrc1       MRVIGTVGMPGSGKSEAATVAANAGIPVLVMGDVIRQECRDRGLDPAQHHGRIAQALRDE
1857|gene|hla       MNVIGTVGLPGSGKGEAANVAEEVGIPVVVMGDVIRAECRRRGLDPAEHHGRMAGTLREE
3047|gene|hwa       MRVIGTVGLPGSGKSEAAAVARRLDIPVVTMGDVIREVCRNRGHDPAEHHGTVAKSLREE
950|gene|hbo        MKVIGTVGLPGSGKGEAASVAREAGVPVVTMGDVIRNECRERGLDPAEHHGRIAKALREE
128|gene|hvo        MRVIGTVGLPGSGKGELAEVARNAGVPVVTMGDVIREECRKRGLDPATDHGKIATALREE
870|gene|nph        MRVIGTVGLAGSGKGEFAAVAEEQGVPVVTMGDVIREACRDRGLDPAEHHGEVAQSLREE
2091|gene|hut       MTVFGIVGLPGSGKSEAAAVARELDVPVVTMGDVIRGACRDRGLDPATHHGEVAKALRAE
13145|gene|hma      MTVIGIVGLPGSGKSEAANVAAEMDVPVVTMGDVIREECRDRGLDPATDHGTVAKALREE
411|gene|hhi        MTVIGIVGLPGSGKSEAANVAAEMGVPVVTMGDVIREECRDRGLDPATDHGTVAKALREE
                    * *:* **:.****.* * **   .:**:.******  ** ** ***  ** :* :** *

2452|chp|nrc1       HGPGAIAHQSLPIIEDHLTDA--TTVLVDGIRSDVEVTTFRDAFGDDFTLVHVSAPRELR
1857|gene|hla       EGDDAIATRTLPLIREAAADGERDTVLVDGLRSTVELERFREAFGDDFTLVAVRAPFEIR
3047|gene|hwa       EGPAAIAERSLPIIKTKLELS--ETVLVDGLRSDIELDCFRDAFGDDFILVSIEAPFKSR
950|gene|hbo        EGLDAIAARSLPLIEAELEDS--DVVLVDGLRSEYELDRFEDAFGDDFVLVSIEAPFDLR
128|gene|hvo        EGDDAIAARSLPMVEQHLESN--DVVLVDGLRSGVELDRFREAFGDDFVLVSVEAPFETR
870|gene|nph        NGPAAIAEASLPHIESALEDA--ATVVVDGIRSGVEVDTFESAFGDDFTLVAIEAPFEER
2091|gene|hut       NGPAAIAEASLPHIEDGLEDS--EHVVVDGIRSDVEVERFQAAFGEEFLLVSVEAPFETR
13145|gene|hma      NGPAAIAERSLPMIEAELESN--DTVLVDGIRSDVEVEAFETAFGDTFLLVEIDAPFELR
411|gene|hhi        NGPAAIAERSLPMIEVELESN--DTVLVDGIRSDVEVEAFESAFGDTFLLVEVDAPFELR
                     *  ***  :** :           *:***:**  *:  *  ***: * ** : ** . *

2452|chp|nrc1       KARIEDRDRPGDTD--GEPLDAREDRERGFGMDDAIDLADVRIENTDSLDAFHDAVRDLL
1857|gene|hla       AERLDDRGRDESDSD-LEALRERDAREIELGLGETLERADVEIDNTGTLAAFRGRVREVL
3047|gene|hwa       VKRLDKRGRDETDLD-ETALQKREERELGFGMGEAMDRADVVIENTESLSKFHETIQYFL
950|gene|hbo        AERLLDRGRDDSDVD-REALKEREERELGFGMGTVMDRADVVIQNTDSLERFRERIQTLL
128|gene|hvo        AERLLDRDRDDSDTD-VEALKKRERRELDFGMGDAMDRADVVIQNTGTLAEYRETITKLF
870|gene|nph        KDRINERGRDGD----GETLAERDNRELRFGLDEALARANVRINNDGSLDAFRERAAEVL
2091|gene|hut       ADRLDLRGRDASVEDGGESLQDRDERELGFGMGEAMEMADVTIENVDSLADFQERIETLL
13145|gene|hma      AKRLDLRGRDTAAEDGGESLEDRDDRELGFGMGEAMELADVTIENTETLAAFQRTVRTLI
411|gene|hhi        ADRLDLRGRDTSAEDGGESLEDRDARELGFGMGEAMEMADLTIENTETLAAFQRTVRTLI
                      *:  *.*         .*  *: **  :*:. .:  *:: *:*  :*  :.     .:

2452|chp|nrc1       A---ADTPHTEVPDNHD------------
1857|gene|hla       G--VAEGEGNADEVADADPATPNAGGDGS
3047|gene|hwa       TQRIVDTTEHADSSQHQHTQ---------
950|gene|hbo        Q----DGPDAVESDESEVEGNA-------
128|gene|hvo        E----EGPEALAEADA-------------
870|gene|nph        E----ST----------------------
2091|gene|hut       T----DGPSALADDERIELAEGNA-----
13145|gene|hma      R----DGPEALNQ----------------
411|gene|hhi        R----DGPEALDQ----------------
                         .