HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0246COG0464KOG0741 KOG0730 KOG0732 KOG0733 KOG0735 KOG0736 KOG0737 KOG0739 KOG0740arCOG04368ATPases of the AAA+ classaaa superfamily atpase

HOG Organism Gene ID Name Annotation
cHOG0246 nrc1 VNG2062 atp aaa superfamily atpase
cHOG0246 hmu HMUK0735 Hmuk_0735 AAA ATPase central domain protein
cHOG0246 hma RRNAC2818 ftsH cell division protein FtsH
cHOG0246 hwa HQ3104A AAA-type ATPase
cHOG0246 hla HLAC1958 Hlac_1958 AAA ATPase central domain protein
cHOG0246 hbo HBOR05130 Hbor_05130 AAA+ family ATPase
cHOG0246 hut HUTA2215 Huta_2215 AAA ATPase central domain protein
cHOG0246 hvo HVO_1907 HVO_1907 cdc48 cell division control protein 48 homolog
cHOG0246 nph NP2252A AAA-type ATPase
cHOG0246 hhi 99 ftsH cell division protein FtsH
MUSCLE (3.6) multiple sequence alignment


2062|gene|nrc1      ------------------------------------------------------------
1958|gene|hla       ---------------------------------------------MSDPALDVVEFVLTT
3104|gene|hwa       ---------------------------------------------MSDRALEIIEFLLTA
5130|gene|hbo       ---------------------------------------------MSDPALEVVEFLLTA
2215|gene|hut       ---------------------------------------------MSEPERDVVEFVLTT
2252|gene|nph       ---------------------------------------------MSSPELDVVEFLLTA
12818|gene|hma      MRLRYTASNVLPVAMFETHRGGILPWCRPSGLRVTYTGCVVTSVGMSNPELDVVEFLLTA
99|gene|hhi         ---------------------------------------------MSNPELDVVEFLLTA
                                                                                

2062|gene|nrc1      ------------------------------------------------------------
1958|gene|hla       HLYTENRDLDENDLPPRFRQVFWSDDAADDA----------------------------P
3104|gene|hwa       HLYTEDRDRDENDLPPRYRRVFWTERSDDSDSDSNSDTGATAGSASEPSADAPDDATDMP
5130|gene|hbo       HLYTENRELDENDLPPRYRRVFWTDPPDDEDEDDETA----------------------P
2215|gene|hut       DVYSEREDLEPDDLPSIYRTVFWEN-----------------------------------
2252|gene|nph       AIYTDNRDLDERDLPPRYRRVFWED-----------------------------------
12818|gene|hma      TIYSERRDLEPDDLPASYRSVFWSD-----------------------------------
99|gene|hhi         TIYSERRDLEPDDLPASYRSVFWSD-----------------------------------
                                                                                

2062|gene|nrc1      ------------------------------MFTDRDAFAGSITLVDDDMAIDWFVDRAAA
1958|gene|hla       GGVERPLKATSETTRTATGVEHPWDAVSDLLFTQRTEFSGEISLTQPAMALEWYRDHADD
3104|gene|hwa       VGIERPLVVTNTVARKATGVEHPWDAVSDLLFTQQEDFSGRISLTQPDMAIEWYIERADH
5130|gene|hbo       IGIERPLVVTDNTARKATGVERPWEAISDLLFTQREDFSGRISLTQPDMATDWYLERADR
2215|gene|hut       GTIERPLVPTVEATSEAADVENPWDTVSGLMFTSHDDFSEEIKLTDRDMAEEWLQKRIEP
2252|gene|nph       GEVERPLTTTTNTAAAATGVDRPWEAISGLMFTDRDDFSGKIEFTDREMAESWFLERVSV
12818|gene|hma      GEIERPLSVTNSTASEATGVERPWAAISGLMFTDRDDFSGSISMTDRDLAEEWFLERVDA
99|gene|hhi         GEIERPLSVTNTTASEATGVERPWAAISGLMFTDRDDFSGSISMTDRDLAEEWFLERVDA
                                                  :**..  *:  * :.:  :* .*  ..   

2062|gene|nrc1      DRISANPVLAFVFG--DEFG--VDYETARDANRPVQADPQWIDGLLEEYF---DEDDEEM
1958|gene|hla       ERIAANPTVVAALEASDDLDAPVTHEEARDSVRPIQADRVWIDALLEEYF--DEDEDGEM
3104|gene|hwa       ERLQTNATIAAAVEDHDDID--ITYAEARERTRPIHADRVWIDSLLEQYFDDDEDEDAEM
5130|gene|hbo       DQLETNPTIAAAVEDHDDVD--VSHTEARERTRSIQADRVWIDSLLDQYF--DEEEDAEM
2215|gene|hut       DELLENPTLASIFD--DEFDE-VSYEKAREQVRPARADRAWIDSLLDEYF--EDEEEEEM
2252|gene|nph       EALRDNPTLAHAFG--DQVDAEVDYETARSKNRPIHADRVWIDSLLEEMF---DEDEEEM
12818|gene|hma      SDLEDNPVLAKAFE--DQVEG-ADYERARQQNRPSRADRAFIDAKLEEAFDTDDEDDEEM
99|gene|hhi         AALEDNPVLAKAFE--DQVEG-ADYERAREQNRPSRADRAFIDAKLEEAFDTDDEDDEEM
                      :  *..:.  .   *:.     :  **.  *. .**  :**. *:: *   :::: **

2062|gene|nrc1      LDLVDVRSPAELTVSLDDIVLTDDQEAEMSKVAKAIEHRDYLATIGLNEVGKLLFVGPPG
1958|gene|hla       LDLVNVRAPEEIETTLADLVLTGDQEGEIQKIVKAIEHREYLASIGLREIGKLLFVGPPG
3104|gene|hwa       LDLVQVRAPEEIEMTLNDLVLTGDQEGEIKKLMKAIEHREYLANIGLREIGKILFVGPPG
5130|gene|hbo       LDLVQVRAPEEIEMTLEDLVLTQDQEGEIHKLMKAIEHREYLADIGLREIGKILFVGPPG
2215|gene|hut       LDLVDIRAPEEVDMRLDDLVLTEDQEGEINKLVKAIEHRDYLARIGLREIGKLLFVGPPG
2252|gene|nph       LDLVEIRAPEEIETTLDDLVLTTDQENEIHKIVKAIEHRDYLAEIGLREIGKLLFVGPPG
12818|gene|hma      LDLVDVRAPEEVEMTLADLVLTTDQEDEIQKIVKAIEHRDYLARIGLREIGKLLFVGPPG
99|gene|hhi         LDLVDVRAPEEVEMTLADLVLTTDQEDEIQKIVKAIEHRDYLARIGLREIGKLLFVGPPG
                    ****::*:* *:   * *:*** *** *: *: ******:*** ***.*:**:*******

2062|gene|nrc1      TGKTSTARGLAHQLDLPFVEVKLSMITSQYLGETAKNVEKVFEVAKRLSPCILFMDEFDF
1958|gene|hla       TGKTTVSRALAHELGIPLVEVKMSMITSQYLGETAKNVEKTFEVAKRLSPCILFIDEFDS
3104|gene|hwa       TGKTTVSRALAHELGLPFVEVKLSMITSQYLGETAKNVEKTFEVAKRLSPCILFIDEFDS
5130|gene|hbo       TGKTTVSRALAHELGLPFVEVKLSMITSQYLGETAKNVEKTFEVAKRLSPCILFIDEFDS
2215|gene|hut       TGKTSVARALAHELDLPFVEVKLSMITSQYLGETAKNVEKTFEVARRLSPCILFMDEFDF
2252|gene|nph       TGKTSVARALAQDLDLPFVEVKLSMITSQYLGETAKNVDKTFEVAKRLSPCILFMDEFDF
12818|gene|hma      TGKTSVARALAHDLDLPFVEVKLSMITSQYLGETAKNVEKVFEVAKRLSPCILFMDEFDF
99|gene|hhi         TGKTSVARALAHDLDLPFVEVKLSMITSQYLGETAKNVEKVFEVAKRLSPCILFMDEFDF
                    ****:.:*.**::*.:*:****:***************:*.****.********:**** 

2062|gene|nrc1      VATTRTGDEHNAIKRAVNTLLKSIDEISLVTDDVLLIGATNHPDELDAAAWRRFDEILSF
1958|gene|hla       VAKTRRSDEHAALKRAVNTLLKSIDEVSLVRDEVLLIGATNHPDQLDAAAWRRFDEIVNF
3104|gene|hwa       VAKTRRSDEHAALKRAVNTLLKSIDDISLIRDEVILIGATNHPDQLDAAAWRRFDEIVNF
5130|gene|hbo       VAKTRRSDEHAALKRAVNTLLKSIDDISLIRDEVILIGATNHPDQLDSAAWRRFDEIVNF
2215|gene|hut       VAKTRASDEHAAIKRAVNTLLKSIDEISLIQDDVLLIGATNHPDQLDAAAWRRFDEIVNF
2252|gene|nph       VAKTRSSDEHAAIKRAVNTLLKSIDEISLIQDDVLLIGATNHPDQLDAAAWRRFDEIVNF
12818|gene|hma      VAKTRSSDEHAAIKRAVNTLLKSIDEISLIQDEVLLIGATNHPDQLDAAAWRRFDEIVNF
99|gene|hhi         VAKTRSSDEHAAIKRAVNTLLKSIDEISLIQDEVLLIGATNHPDQLDAAAWRRFDEIVNF
                    **.** .*** *:************::**: *:*:*********:**:*********:.*

2062|gene|nrc1      PRPDEGMRADIISLVTSEVDIADFDPAALAAETSGLTGSDLRLVLREAVLDALVEDRTEL
1958|gene|hla       PKPDRDMRADILRVVTREMQIADFDPEEVADRTTGLTGSDLRMVLREAVLGALTEDRMTI
3104|gene|hwa       PKPDRNMRADILKIITDRMDITEFDPVSIAERTDGLTGSDLRMVLREAVLEALTEERTTL
5130|gene|hbo       PRPDRQMRADILRIITNRMEVADFDPEAVADRTEGLTGSDLRMVLREAVLEALTEERTAL
2215|gene|hut       PKPDKGMRSDILQVVTRDMEIDDYDPGELAGMTEGLTGSDLRLVLREAVLNALTEERTTL
2252|gene|nph       PKPDRDMRADILRIVTRRMDVDDFDPEALAEATEGLTGSDLRLVLREAVLDALTEERTTL
12818|gene|hma      PKPDSGMRADILRIVTQQMEIDDFDPETLADLTEGLTGSDLRLVLREAVLNALTEERTTL
99|gene|hhi         PKPDHGMRADILRIVTQQMEIDDFDPETLAELTEGLTGSDLRLVLREAVLNALTEERTTL
                    *.**  **:**: ::*  ::: ::**  :*  * ********:******* **.*:*  :

2062|gene|nrc1      TQDDLMAAISEFEDRDHLRNLDTLEDALD----------------DTHSDHTHDDH-PAP
1958|gene|hla       TQQDVMEAVEDFEERDNLKNMDMIDGEGAEVLGETDPDGQDHTHDDEGDDTAHDHGAHSH
3104|gene|hwa       TQRDIINAVEDFEERDNLKNMNMM-SDGDQLVAGDGSGKTDTAETDHDHDHDHDHD-HNH
5130|gene|hbo       TQTDILDAVEDFEERDNLKNMDMM-SDGEQLIAG-----------DGGDGHDHDHN-HDD
2215|gene|hut       TQEDLVNAVANFEERDNLKNLDMIEGDHDALVAGGTP------SADGGHDHDQGHD-HSH
2252|gene|nph       TQDDLLEAIEGFEERDNLKNMDMIEGDADALIAD----------GSDGHDHDHDHD-H--
12818|gene|hma      TQQDLEDAIIDFEERDNLKNMDMMDGDADALVAGSGG-----FSGDGGSDHDHDH-----
99|gene|hhi         TQQDLEDAIIDFEERDNLKNMDMMDGDADALVAGSGG-----FSGDGGSDHDHDHD-H--
                    ** *:  *:  **:**:*.*:: : .                   .   .  :.      

2062|gene|nrc1      NPE
1958|gene|hla       SHD
3104|gene|hwa       ---
5130|gene|hbo       ---
2215|gene|hut       SDD
2252|gene|nph       ---
12818|gene|hma      ---
99|gene|hhi         ---