HOG Organism Gene ID Name Annotation
aHOG2459 hut HUTA0120 Huta_0120 conserved hypothetical protein
aHOG2459 hut HUTA0904 Huta_0904 conserved hypothetical protein
aHOG2459 nrc1 VNG0469 vng469 no entry
aHOG2459 nrc1 VNG1894 vng1894 no entry
aHOG2459 hma Hma_12074 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


469|hp|nrc1        MPTPRSRIREAVPDAEAAVELARVDL---VRGYRKLRGQD---FWLLYGALSAVGFALIT
904|chp|hut        ----------------------------------MIAGIVVGLFYALIGAV---------
12074|hp|hma       ---------MRRPNGRRMRLIAQTEL---RRTWRKLMGTARGTLMLLGGGLGIVIYSLAI
120|chp|hut        --------MSALDHSVRLARIDVTRMLRKHTDWRS--GSSSIIGLVMYVLLVLVG-TLGG
1894|chp|nrc1      --------MPGVPNTHHAARIAATQL---RIGWRKLRGKSVTHHFAVGLAVVAVT-AMTP
                                                        *        :   :         

469|hp|nrc1        VYAYSLGHDTGVALAAG----ETPWFAAGGAATAWSVAWLFTVAMLVVEAVGSNGDLDND
904|chp|hut        -----MAFFLGSLVAEE----GLSTMTQPRMVALAVL--VIGTFIVAQRTVKRTGSLDAP
12074|hp|hma       GV---MAFFFGGALTGS----DTQTVRLATTAGIVGLLGLVGFFTLQH-TVKSAGEPDAA
120|chp|hut        G--Y-LGYRMGTSLAEGGPLFGIGTFSTPIAGGILALFWLIITVIFAVRAVGQRGTLAQP
1894|chp|nrc1      GITW-VVYANAQSVVDGAS--AIGTLVPAGIG-------VVTVVMTAYLTVLQIGDIDVR
                        : .  .  :.          .             :.        :*   *     

469|hp|nrc1        GHYLTLRPTADITAGKLASAAVKLAGFMLFPALGLALGLSLGLGTPVPVLGVVAAATVTV
904|chp|hut        GAVLTAASPAAVAVGVMGAEFGRALLFLGVPAGVTILAYGLGTGDPLAAVVLAAVALGVL
12074|hp|hma       DGLLTTVPYEDAAAGLLAAEVGRVLLAVTIPILALVGGLAVGDAGVLVAVVALVGSVAVT
120|chp|hut        EGILTVVPTREALAGVYVAEFTYVVLWVLGPAVGLGAGLALGSGVLWPVVTVPVAILAAG
1894|chp|nrc1      DGYLTTVPARDVVGGLLAAGYVRVAGMFVPPLLVASVGLAGGVGRPLALLSAPIAVLALT
                      **  .      *   :        .  *      . . * .     :          

469|hp|nrc1        TSAAATGYPVGFLLKGVVRRSNVLTQLKPVLG-VGIGLGYFAVMLTGEFTTAIDALRPVL
904|chp|hut        AVVISVGFAAGMAARRVSMRSQFVTRHRGKLGVVGTFLAFGGYMFFLEGHALSRAIVDPL
12074|hp|hma       LLGTVLGFSLGLVIKLVANRSAFIARHRASVGAAVSLVLPLGWVAMTTVPTVQFRVLQLA
120|chp|hut        LTAVTVGYPIGLSVRHVASRFPFVAQHKGVIL-VMVFLGYFAALSTGTVDQLMVALFEPM
1894|chp|nrc1      TTAYLVGFPIGMVIAYALGQSAFVDRYKGALG-AGAFVAYLALLLTDSLWTVAGPVIEAA
                         *:. *:    .  .  .: . .  :  .   :   . :           :    

469|hp|nrc1        RAPPLCWLGDLSLATTPGVTPGATGVAGALALGVVVAGAGVLLAVPAARYAWRADGMAST
904|chp|hut        LGLPPAWLGDLALAGTPNVSASSGQLLGAVGVVVLGVPIGARAGVALSRRVWFGERVRPA
12074|hp|hma       TQSPLSWPADVVLL-VLGAGGDPVAATVATVGVLSALPVGVVACLWLAARAWYVDPVQPD
120|chp|hut        QASPMAWYADLLFLGTPGVEGSLAKASGAVAFTLVFTVAGTIAGSRVAGIHWFSDPALAG
1894|chp|nrc1      RASPVAWYTDLALITVPGADASALRAGAVLAGSVGVAALGVLASVRVSERRWYDDGAHAD
                      * .*  *: :  . ..  .      .    :     *.      :   *  :   . 

469|hp|nrc1        ESDGEPTTAPDHAV--DRLLGVLTRAPATHGVASTALLQIYRSPLRLVFVAFPLVGAIPV
904|chp|hut        ERSGVTVAGTDLLG--WLPDAHL--PVATRAVVRKSVLRARRSPFIVQYALVPYFVLAMF
12074|hp|hma       YEFDADKQTLSD----RLLRGRV--STATRVVAQKSWLRAKRAPISVQFAIMPFFFLVYH
120|chp|hut        AEPDPVATEAASPGIERRIESVL--GPRTAALITLSWRRAVRAPLKLLYAFFPVLMMGGF
1894|chp|nrc1      IRTTDSARG-------GRLDGVL--GRPAAWVARKSWLRARRAPIKLLYVIYPVFVLFGP
                                       . :     :  :   :  .  *:*: : :.  * .     

469|hp|nrc1        -GEQVLAGGTVPRYAPWLAVWYGAWAGGAALPLNPLGNQGKSLPSLLTARAGGRHVVRGY
904|chp|hut        GIQFAIQSGSIPSWLTHGMAVAGVVATGTAFALNPIGGEEGLLPITLTCGVDSRSFLAGL
12074|hp|hma       -LQIVILERVVPPTLPLSAGLASAAAFGAAFSLNPLGGEEGVLPLTLTANVSGRAFVTGL
120|chp|hut        -LADIVQSGEIPPHLPFVAVVVAAWAAGVIFTLNPLGDQGAALTSTLLSRVDGRTFVHAH
1894|chp|nrc1      -IQNSIAAGRVTATLPATLTLYAAWATGALFALNPLGDEGAVLPVTATSGVAGREVVAGL
                        :    :.   .      .. * *. :.***:*.:   *.    . . .* .: . 

469|hp|nrc1        VAATGVVAVPVSGAVAGLLAGAAGYSLGGVLGVVVAAGSAVLAASVLAAGVGSVFPRFEG
904|chp|hut        TVAGWVVGIPATVGGTILSGFLLGIPPMTIGSIVLVASGMALGAPGIAMFGGVVFPSIET
12074|hp|hma       VLAGALPGVVVTTLLVVGLGVAAGTPPVTLAAGLTVALAATLAAPAIAVGAGVVFPKFES
120|chp|hut        LLAGLAIAIPIGTVLTAVLAVLSPIESETALALVLATPVVMVLSAAFSIGVGMTFPRFEA
1894|chp|nrc1      VAASALVGTPVSIVLAVVLGVLSPLSSVAVACLAVGGVVLPALAATVAAGVGASFPKYEA
                     *    .       .   .                       :. .:   *  **  * 

469|hp|nrc1        VDLAGSRRAVPPSKVAYGVFSATLTAAVVAATVVRSEVLHDAVTVL-----VSRTLPFGW
904|chp|hut        QSLPGGSETVEPSTYAFLLFAVGLGIAALPVTVAWAVGTGPVVLVLAAVGSVGLAWLFGW
12074|hp|hma       SSVQG-HEVVVPSGWAFGLYFLVLGVAVAPGSLTYLLAVRDLFSLP-----FDKTWLLG-
120|chp|hut        VNVTRSMKTVLPSRWAFVLFSAYLFVTAAAAGVVYESSVRDLAAGL-----VSWALPFGL
1894|chp|nrc1      TSMTRSREVVVPSLWSFGVYTIVFLLSAGIATGAQSPAVGSVLGSV-----------LGV
                    .:     .* **  :: ::   :  :.     .                       :* 

469|hp|nrc1        RVSAGTVETGAFVALAAVAVALPVAYRVAVARLGGYRLA----
904|chp|hut        -----------------------AGFRYTVTQLDGYVPDPDLL
12074|hp|hma       --------GGLVVSIGIASAGAVAGFLYAANRVATYRLD----
120|chp|hut        SVSADTLYFLSAVLLVGAVILPVVSYRHAVRRFDGYTMA----
1894|chp|nrc1      STAVVHV-AGLAVGLAVAGACAVVAGRNAVRAFDGYTADG---
                                          ..   :.  .  *