HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0243COG1100KOG1707 KOG0070 KOG0072 KOG0073 KOG0084 KOG0087 KOG0092 KOG0096 KOG0393 KOG0395 KOG1532 KOG1533 KOG1673arCOG00354GTPase SAR1 and related small G proteinsGTP-binding protein homolog

HOG Organism Gene ID Name Annotation
cHOG0243 nrc1 VNG2410 gbp3 GTP-binding protein homolog
cHOG0243 hmu HMUK0814 Hmuk_0814 GTP-binding protein HSR1-related
cHOG0243 hma RRNAC2710 gbp3 GTP-binding proteinlike
cHOG0243 hwa HQ3738A GTP-binding protein
cHOG0243 hla HLAC2746 Hlac_2746 GTP-binding protein HSR1-related
cHOG0243 hbo HBOR02100 Hbor_02100 small GTP-binding protein domain
cHOG0243 hut HUTA1615 Huta_1615 small GTP-binding protein
cHOG0243 hvo HVO_3014 HVO_3014 gbp GTP-binding proteinlike
cHOG0243 nph NP0594A GTP-binding protein
cHOG0243 hhi 3105 gbp4 GTP-binding protein HSR1-like protein
MUSCLE (3.6) multiple sequence alignment


2410|gene|nrc1      MGCEWRARMGLFADLRDSVSRVTASLFADDSEPKRIGIYGPPNAGKTTLANRIARDWTGD
594|gene|nph        --------MGLLTDLKSSISRATSSLFAGD-ETKRIGIYGPPNAGKTTLANRITRDWTGD
12710|gene|hma      --------MGLLTNLKDSISRAASTLFSEE-DPKRIGIYGPPNAGKTTLANRIARDWTGD
3105|gene|hhi       --------MGLLTNLKDSISRAASTLFSEE-DPKRIGIYGPPNAGKTTLANRIARDWTGD
1615|gene|hut       --------MGLLTELRDSISRAASSLFSEQ-DPKRIGIYGPPNAGKTTLANRIARDWTGD
2746|gene|hla       --------MGLLTNLKDSISRVTDGLFTAD-EPKRIGIYGPPNAGKTTLANRIARDWTGD
3738|gene|hwa       --------MGLITNLRKNIVRVVDRLFSDS-DPKRIGIYGPPNAGKTTLANRIARDWTGD
2100|gene|hbo       --------MGLLTELRDSISRVVDRMFSDA-EPRRIGIYGPPNAGKTTLANRIARDWTGD
                            ***:::*...: *..  :*:   :..*******************:******

2410|gene|nrc1      AVGPESHIPHETRRARRKENVEIERNGKTVTIDIVDTPGVTTKVDYSQFLDHDMEKDEAV
594|gene|nph        AVGPESHVPHETRRARRKENVEIKRNGKSVTIDVVDTPGVTTKVDYKEFLDHDIDKDDAV
12710|gene|hma      AVGPESHVPHETRRARRKENVEIERDGKKVTIDIVDTPGVTTKVDYTEFLEHDMEKDDAV
3105|gene|hhi       AVGPESHVPHETRRARRKENVEIERDGKKVTIDIVDTPGVTTKVDYTEFLEHDMEKDDAV
1615|gene|hut       AVGPESAVPHETRRARRKENVEIERDGKSVQIDIVDTPGVTTKVDYTEFLDHDMEKDDAV
2746|gene|hla       AVGPESHIPHETRRARRKENVEIERNGRKVTIDIVDTPGVTTKVDYKEFLDHDMDKDDAV
3738|gene|hwa       AVGPESQIPHETRRARRKENVEISRDGKTVNIDIVDTPGVTTKVDYKEFLEHDMEKDDAV
2100|gene|hbo       AVGPESHIPHETRRARRKENVEIERNGKKVTIDIVDTPGVTTKVDYKEFLDHDMEKDDAV
                    ****** :***************.*:*..* **:************.:**:**::**:**

2410|gene|nrc1      RRSREATEGVAEAMHWLREDVDGVIYVLDATNDPFTQVNTMLIGIIESRDLPVLILANKT
594|gene|nph        RRSREATEGVAEAMHWLREDVDGVIYVLDATEDPFTQVNTMLIGIIESQDLPVLIFANKI
12710|gene|hma      RRSREATEGVAEAMHWLREDVDGVIYVLDSATDPFTQVNTMLIGIIESQDLPVLILANKI
3105|gene|hhi       RRSREATEGVAEAMHWLREDVDGVIYVLDSATDPFTQVNTMLIGIIESQDLPVLILANKI
1615|gene|hut       RRSREATEGVAEAMHWLREDVDGVIYVLDSAKDPFTQVNTMLIGIIESQDLPVLIFANKI
2746|gene|hla       RRSREATEGVAEAMHWLREDVDGVIYVLDSTTDPFTQVNTMLIGIIESQDLPALILANKT
3738|gene|hwa       RRSREATEGVAEAMHWLREDVDGVIYVLDSTQDPFTQVNTMLIGIIESQDLPVLIFANKT
2100|gene|hbo       RRSREATEGVAEAMHWLREDVDGVVYVLDSTEDPFTQVNTMLIGIIESQDLPVLIFANKT
                    ************************:****:: ****************.***.**:*** 

2410|gene|nrc1      DLDDANIQRVSNAFPQHETIPLSALEGENMDEVYDKIAAYFG
594|gene|nph        DLEDANVQRISNAFPQHETVPLSALEGDNMDEVYDKIAEYFG
12710|gene|hma      DLEESSVQRIRNAYPQHETIPLSALEGDNMDEVYDKIAEYFG
3105|gene|hhi       DLEESSVQRIRNAYPQHETIPLSALEGDNMDEVYDKIAEYFG
1615|gene|hut       DLDDSSVKRIRNAFPQHETVPLSALEGDNMDEVYDKIAEYFG
2746|gene|hla       DLPGSDVQKIANAFPQHETIPLSALEGENMDEVYTKIAEYFG
3738|gene|hwa       DLTASNVQQISNAFPQHETVPLSALEGTNMDEVYGKIAEYFG
2100|gene|hbo       DLEESNVQRISNAFPQHETVPLSALEGNNMDEVYDKIAEYFG
                    **  :.::.: **:*****:******* ****** *** ***