HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0242COG0142KOG0776 KOG0711arCOG01726Geranylgeranyl pyrophosphate synthasegeranylgeranyl diphosphate synthase

HOG Organism Gene ID Name Annotation
cHOG0242 nrc1 VNG1150 idsA geranylgeranyl diphosphate synthase
cHOG0242 hmu HMUK2608 Hmuk_2608 Polyprenyl synthetase( EC:2.5.1.29,EC:2.5.1.10 )
cHOG0242 hma RRNAC0081 idsA geranylgeranyl diphosphate synthase
cHOG0242 hwa HQ2889A idsA trifunctional short-chain (E)-prenyl diphosphate synthase ( dimethylallyltransferase / geranyltranstransferase / farnesytranstransferase)
cHOG0242 hla HLAC2048 Hlac_2048 Polyprenyl synthetase
cHOG0242 hbo HBOR11930 Hbor_11930 farnesyl-diphosphate synthase /geranylgeranyl- diphosphate synthase (EC 2.5.1.29)( EC:2.5.1.29,EC:2.5.1.10 )
cHOG0242 hut HUTA2049 Huta_2049 Polyprenyl synthetase
cHOG0242 hvo HVO_2725 HVO_2725 idsA geranylgeranyl diphosphate synthase
cHOG0242 nph NP3696A idsA_3 trifunctional short-chain (E)-prenyl diphosphate synthase ( dimethylallyltransferase / geranyltranstransferase / farnesytranstransferase )
cHOG0242 hhi 838 idsA geranylgeranyl diphosphate synthase
MUSCLE (3.6) multiple sequence alignment


1150|gene|nrc1      MSQEARERAVLAAVRERRQQVNDAIDDDLPVAEPERLYEASRYILEAGGKRLRPAVLLLT
2048|gene|hla       MTSETKEARVLEAIRERRELVNAAIDEELPVQHPERLYEATRYILEAGGKRLRPTVTTLA
2889|gene|hwa       MSSDATEERVLEAVRARRTLVNDALDTDVPMQSPERLYEATRYLLEAGGKRLRPTVALLT
11930|gene|hbo      MSSEATEERVLDAVKARRELVNDALDEDVPMADPERLYEATRYLLEAGGKRLRPTVTLLT
2049|gene|hut       MTDTVDSQAVMEAIEWRRGQVNDAIPENLPVVEPKKLYEASRYLLDAGGKRLRPTILLLV
3696|gene|nph       ---MTSADHVESAIAERREIVNEAVSEQLPVQKPERLYSASRYLLDAGGKRLRPTILLLA
10081|gene|hma      --MSERHQQVEDAIVARRDRVNDALPEDLPVQKPDHLYEASRYLLDAGGKRLRPTVLLLV
838|gene|hhi        --MSERHQQVEDAIVARRDRVNDALPEDLPVQKPDHLYEASRYLLDAGGKRLRPTVLLLV
                             *  *:  **  ** *:  ::*:  *..**.*:**:*:********::  *.

1150|gene|nrc1      AEALADTSD-TPPYREFPDCIGGHVDVMSAAVSIEVIQSFTLIHDDIMDDDDLRRGSPAV
2048|gene|hla       AEAVTGTDPLSADFREFAALDGNTVDVMRAAVAIEVIQSFTLIHDDIMDEDDLRRGVPAV
2889|gene|hwa       AESLADVDPLTADYRSFPALDGSEVDVMSAATSIEVIQSFTLIHDDIMDDDDLRRGVPAV
11930|gene|hbo      AEALADAEPLSEDYRSFPALDGADIDVMAAAVSIEVIQSFTLIHDDIMDDDDLRRGVPAV
2049|gene|hut       AESIADVLPRSEPYREFPAAEG-PIDMMSAAVSIEIIQSFTLIHDDIMDDDDMRRGVPAV
3696|gene|nph       AESLADVEPLSADYRQFPSLPGDEVDVLSAAVSIEVIQSFTLIHDDIMDDDDLRRGVPAV
10081|gene|hma      AESLLDVDPLTADYRDFPTLEGGQADMMSAALAIEVIQTFTLIHDDIMDDDALRRGVPAV
838|gene|hhi        AESLLDVDPLTADYRDFPTLEGGQADMMSAALAIEVIQTFTLIHDDIMDDDALRRGVPAV
                    **:: ..   :  :*.*.   *   *:: ** :**:**:**********:* :*** ***

1150|gene|nrc1      HREYDTETAILAGDTLYSKAFEIMLETGAPPERGLRAMRTLAETCTHICEGQAMDIDFET
2048|gene|hla       HEQYDISTAILAGDTLYSKAFEFMTETGSDPANGLEAMRMLATTCTEICEGQSLDVSFES
2889|gene|hwa       HREYDTETAILAGDTLYAKAFELLSNTGADPANGVAAVSRLATTCTQICEGQALDVEFEH
11930|gene|hbo      HKEYDTETAILAGDTLYAKAFEFMTQTGADPQNGLEAVRLLATTCTKICEGQALDVEFER
2049|gene|hut       HREFDLSTAILAGDTLYAKAFENMLETGSTGDRSVRALSELATTCTQICEGQSMDIEFET
3696|gene|nph       HREYDLETAILAGDTLYSKAFEYMLDTGAPAERSVEALDELATTCTEICEGQALDVDFEN
10081|gene|hma      HKEYDLSTAILAGDTLYSKAFEFLLETGAAHERTVDANKRLATTCTRICEGQSLDIEFEQ
838|gene|hhi        HKEYDLSTAILAGDTLYSKAFEFLLDTGAAPERTVEANKRLATTCTRICEGQSLDIEFEQ
                    * ::* .**********:**** : :**:   . : *   ** *** *****::*:.** 

1150|gene|nrc1      RGDVVTDEYLEMVELKTAVLYAAAATLPGLLLSADEETVEALYNYGLRVGQAFQIQDDVL
2048|gene|hla       RDDILPEEYLEMVELKTAVLYGASAATPAVLLGADDEVVDALYQYGIDSGRAFQIQDDVL
2889|gene|hwa       RDAVLPEEYLEMVELKTAVLYGAATSTTALLLDADADVVDALYQYGIDAGRAFQIQDDVL
11930|gene|hbo      RTEVLPDEYLEMVELKTAVLYGAAAATAGVLMGADDETVEALYRYGIDSGCAFQIQDDVL
2049|gene|hut       DETVTTEDYLEMVELKTAVLYAAAASIPPILMGEDD-YVDPLYQYGLNIGRGFQIQDDLL
3696|gene|nph       RSDVTTEEYLEMVEFKTAVLYAAAASIPAILLGSDDETVEALHGYGLDIGRAFQIQDDLL
10081|gene|hma      RDVVTPEEYLEMVELKTAVLYGAAASIPATLLGADEQTVDALYNYGLDVGRAFQIQDDLL
838|gene|hhi        RDVVTPEEYLEMVELKTAVLYGAAASIPATLLGADAETVDALYNYGLDVGRAFQIQDDLL
                       : .::******:******.*::: .  *:. *   *:.*: **:  * .******:*

1150|gene|nrc1      DLTVPSAELGKQRGSDLVEDKTTIITLHAAEHGVDVDGLLDAEDPADVTEAAVQAAVQAL
2048|gene|hla       DLTVASEELGKQRGSDLVEGKETLITLHARQQGVDVDGLVDADTPAEVTEEAIEDAVAAL
2889|gene|hwa       DLTVPSEQLGKQRGSDLIENKETLITLHARQQGIDVESLLESTDIDAVSEAAVENAVATL
11930|gene|hbo      DLTVPSEKLGKQRGSDLVENKETLITLHARQQGVNVEDLVAADTVEGVTEDDIDAAVAEL
2049|gene|hut       DLTTPSEKLGKQRGSDLVENKRTIITVHARNQGVDVENLVPTDDVDAVDEATIDEAVAEL
3696|gene|nph       DLTAPSDELGKQRGSDLVENKRTVITLHARDQGIDVEGLVSDDP----SDAEIEAAVQTL
10081|gene|hma      DLTTPSEKLGKQRGSDLVENKQTLVTLHARQQGVDVGDLVDTDSVEAVSEAEIDDAVERL
838|gene|hhi        DLTTPSEKLGKQRGSDLVENKQTLVTLHARQQGVDVGDLVDTDSVEAVSEAEIDDAVERL
                    ***..* :*********:*.* *::*:** ::*::* .*:         :  :: **  *

1150|gene|nrc1      QDAGSIQYASDLAEDLVEEGKAHLEVLPENEARHRLEQIADYLIERGY
2048|gene|hla       EEVGSIAYARETAEDLTRRSKEHLEILPESGSRELLADLADYLIVRGY
2889|gene|hwa       DEAGSIEYASNTATDLVERAKNHLEVLPDNDARSLLCDIADYLITRGY
11930|gene|hbo      NKVGSIDYARDKAQELTDRAKRHLEVLPDNDARSLLADISDYLISRGY
2049|gene|hut       EEAGSIDFARETAEGLIRDGKRNLEVLPDNESRDLLEGIADFLIEREY
3696|gene|nph       EDAGSIDFAREMALDLVTSGKERLDVLPENEARQLLEDIADFLVERSY
10081|gene|hma      REVGSIEYARQTGQDLIASGKQNLEVLPDNEARYLLEGIANYLVERDY
838|gene|hhi        REVGSIEYARQTGQDLIASGKQNLEVLPDNESRYLLEGIANYLVERDY
                     ..*** :* : .  *   .* .*::**:. :*  *  ::::*: * *