HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0241COG0088KOG1624 KOG1475arCOG04071Ribosomal protein L450S ribosomal protein L4E

HOG Organism Gene ID Name Annotation
cHOG0241 nrc1 VNG1690 rpl4e 50S ribosomal protein L4E
cHOG0241 hmu HMUK1829 Hmuk_1829 ribosomal protein L4/L1e
cHOG0241 hma RRNAC1610 rpl4lp 50S ribosomal protein L4P
cHOG0241 hwa HQ2841A rpl4lp 50S ribosomal protein L4P
cHOG0241 hla HLAC2448 Hlac_2448 ribosomal protein L4/L1e
cHOG0241 hbo HBOR10240 Hbor_10240 LSU ribosomal protein L4P
cHOG0241 hut HUTA2293 Huta_2293 ribosomal protein L4/L1e
cHOG0241 hvo HVO_2563 HVO_2563 rplD ribosomal protein L4/L1 family
cHOG0241 nph NP4856A rpl4lp 50S ribosomal protein L4P
cHOG0241 hhi 2153 rpl4lp 50S ribosomal protein L4P
MUSCLE (3.6) multiple sequence alignment


2448|gene|hla       MNATVHDLDGGDAGSVELPAIFETAFRPDLIGRAVSAAQANRKQAYGADEFAGLRTPAES
11610|gene|hma      MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAES
2153|gene|hhi       MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAES
4856|gene|nph       MKATVRDLDGDDAGEVELPAVFETDYRPDLIKRAVLAAQANRIQDTGTDEYAGLRTPAES
2293|gene|hut       MQATLHDLDGDAADEIELPDVFETPYRPDLIKNAVLAAQANRKQDHGADEYAGMRTPAES
1690|gene|nrc1      MQVTVRDLDGDDAGTLDLPRVFEEPVRPDLVKRAVLAAQANRTQEYGADEYAGLRTTAES
2841|gene|hwa       METTIHNLNGDKADTLELPAVFETPYRPDVIERAVVAAQANRKQPYGADPYAGMRTPAES
10240|gene|hbo      MQATIRDLNGDDAGTLDLPEVFETAYRPDLIKRAVLAAQANRKQAYGADPYAGMRTPAES
                    *:.*: :*:*.  . ::** :**   *.*:: .** ****** *  *:* :**:**.***

2448|gene|hla       FGSGRGLAHIPRSENVARRVPNAVSGRAAHPPKAEKDQTKSLNDKERQLAIRSAIAATAD
11610|gene|hma      FGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATAD
2153|gene|hhi       FGSGRGQAHVPKQDGRARRVPQAVKGRSAHPPKAEKDRSLDLNDKERQLAVRSALAATAD
4856|gene|nph       PGSGRGMAHVPRQNGRAREVPQAVSGRPAHPPKAEKDRGLDINTKERKLATRSAIAATAN
2293|gene|hut       QGSGRGQAHVPQQDGRSRRVPQTVGGRRAHPPKAEADPAPALNDKERKLATRSAIAATAD
1690|gene|nrc1      QGSGRGMAHVPKANGQGARVPQTVGGRKAHPPKAEKDHGLDVNDKERKAAVRAAVAATTD
2841|gene|hwa       FGSGRGMAHVPRENGQARRVPQAVSGRKAHPPKAEKDQSKSVNTKERKLAFQSAVAATAD
10240|gene|hbo      LGSGRGMSHDPRENGRARRVPHAVSGRKAHPPKAEKDQGKEINKKERKLAVRSALAATTD
                     ***** :* *. :. .  **::* ** *****:* *    :* ***: * .:*:***::

2448|gene|hla       AETVAERGHAFDEDLDLPLVVSDEFEDLNKTQEALGVLEAVGADADIERAEEGRSVRAGR
11610|gene|hma      ADLVADRGHEFDRD-EVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADE-TKIKAGQ
2153|gene|hhi       ADLVADRGHEFDRD-EVPVVVSDDFEDLVKTQEVVSLLEALDVDADIDRADE-TKIKAGQ
4856|gene|nph       ADRVEERGHEFDEETDLPLVVSDEFEDLVKTQEAVDVLEALGVYDDIERAEDGKTVRAGR
2293|gene|hut       AELVDARGHAFDDETDLPLVVSDDFEDLVKTQAVVDVLEALGVDADIERADD-RTVRAGQ
1690|gene|nrc1      SELVADRGHNFDDDVEFPLVVSDDFEDLVKTQDVVSLLEALGVHADIERADEGRTVRAGQ
2841|gene|hwa       PSQVEERGHQFENDVELPLVVSDEFEELIKTQEVVDVLESLGVHADIVRSDENKSIRAGR
10240|gene|hbo      AELVAERGHRFDEDLDLPLVVSDDFEDLVKTKEVVSLLESLGVHADVEHSEDNKKVRAGQ
                    .. *  *** *: : :.*:****:**:* **: .:.:**::..  *: .:::  .:.**.

2448|gene|hla       GKTRGRKYSQPKSVLVVTSEE--PSRAARNLSGVDVATAREVNAEDLAPGAHPGRLTLWT
11610|gene|hma      GSARGRKYRRPASILFVTSDE--PSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFT
2153|gene|hhi       GSARGRKYRRPASILFVTSDE--PSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFT
4856|gene|nph       GTTRGRKYTEPKSVLVVTSDD--QSLAARNLAGSDVATADEVNVEDLAPGTQAGRLTLWT
2293|gene|hut       GTTRGRKYRTPKSVLFVTSEE--PSKAARNLAGADVTTAREVNAEDLAPGTDAGRLTLWT
1690|gene|nrc1      GTLRGRKYQEPTSILFVTASESGPSTAARNLAGVDVATGREVNAEDLAPGAEPGRLTVWT
2841|gene|hwa       GKTRGRKYRRPKSILFITSDE--PSKAARNLAGADVVTAANVSAEDLAPGTQPGRLTVYT
10240|gene|hbo      GKARGRKYKRPKSILFVTSEE--PSKAARNLAGVDVATASNVNAEDLAPGTHAGRLTIFT
                    *. *****  * *:*.:*:.:   * *****:* **.*. :*..******  .****::*

2448|gene|hla       ESAIEEVADR
11610|gene|hma      ESALAEVAER
2153|gene|hhi       ESALAEVAER
4856|gene|nph       ESALAEVAER
2293|gene|hut       ESAIAEVADR
1690|gene|nrc1      ESAVEEVAQR
2841|gene|hwa       ESAIKEVADR
10240|gene|hbo      ESAVEEVADR
                    ***: ***:*