HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0240COG0433arCOG00280Predicted ATPasehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0240 nrc1 VNG1896 vng1896 no entry
cHOG0240 hmu HMUK1658 Hmuk_1658 conserved hypothetical protein
cHOG0240 hma RRNAC3396 hypothetical protein
cHOG0240 hwa HQ3070A ATPase
cHOG0240 hla HLAC1979 Hlac_1979 Tubulin
cHOG0240 hla HLAC2787b Hlac_2787 hypothetical protein
cHOG0240 hbo HBOR07980 Hbor_07980 predicted ATPase, COG0433
cHOG0240 hut HUTA1379 Huta_1379 conserved hypothetical protein
cHOG0240 hvo HVO_2367 HVO_2367 conserved protein
cHOG0240 nph NP5026A ATPase
cHOG0240 hhi 625 HAH_0625 putative ATPase
MUSCLE (3.6) multiple sequence alignment


2787|hp|hla        -----MTEDFSLDDARAEDER--------------ASEEATDETQLKDAPA---------
3070|gene|hwa      -MDLGDFDPSDADSETETDEEDTNSPEDERIINAARESPASEPGQKTDADTGMNTHIEKS
1979|gene|hla      -MTLEDFTEFGDDEGDGGGDAAADPATAGRGGTERDGEDATDGADKNSIDG---------
7980|hp|hbo        MSDLGDFTDFEDDPDTESSSHTTDASATEEAQTR-EQSPQSDSEPSTDTDG---------
1896|chp|nrc1      MSDLGDFADHGRDDDERGG----------------------DDDPAPADDD---------
13396|hp|hma       MSDLGDFTDFDGDDAAADDEAAQSAETADDGDGAVDASEETDPTTQSADDD---------
625|gene|hhi       MSDLGDFTDFDGDDAAADDEAADSAETTDDSDRAVDASGSTDPTTQSTDDD---------
1379|chp|hut       MSDLGDFTEFDNDDAGE------------------QASEGSDAPERASTDD---------
5026|gene|nph      MSDPGRFDSFGDDD---------------------------ERDDTNDGDD---------
                               *                            :                  

2787|hp|hla        -------------------PFGDHNGERVGHITAQDN-PIVVDREESVIRAFVDSDSREG
3070|gene|hwa      QEETTSNTESPTFDSYDITPIKQDVG--LGTIAVSQGLRIAEDDDETQLRAYVTADNRDR
1979|gene|hla      ---DGEDATDGGFAAYDVEPTGEDVG--LGVVSVSQGLRVAEDADETTLKAFVTAGNREA
7980|hp|hbo        ----------VSFETYDVSPAGEDRG--IGAVSVSQGLRVAEDGDETTLRAFVTTGNRDD
1896|chp|nrc1      ------------FDRPTLEATGSDDG--LGALAVSEGLRIHEDGQETALKAYVTAGNRAA
13396|hp|hma       ------------FEDMDVTPAGTDTG--LGVLSAANGLRISEEAEETVLRAYVTARNRSR
625|gene|hhi       ------------FEDMDVTPAGTDTG--LGVLSAANGLRISEEAEETVLRAYVTARNRSR
1379|chp|hut       ------------FEPVETTPTGEERG--IGVLSAAEGLTISEDGEDTRLRAYVTVGNRAD
5026|gene|nph      ------------FEAVSATPVGTDRG--IGTISASAGLRISEDDDDTRLRAYVTADNRHD
                                      .     *  :* ::.  .  :  : ::: :.*:*   .*  

2787|hp|hla        VRLGNYLRIPYAPL---EDEEYSRAMLVGVIKRLEYATIADINDKQDGGYANPPGEHSFS
3070|gene|hwa      IRIGTYLLVPY-PD---GEMLFCRIAAVEYAQEFHTDDATEIHARR-AMRRDEFTERDYK
1979|gene|hla      VRLGKYLLVPY-PD---GERLFCRITGLEYAQEFRSDDATEIHARR-QMRRDDFAERDYK
7980|hp|hbo        VRLGKYLLVPY-PD---DELLFCRITALEYAQEFQTDDATEIHARR-AMRQQGFEERDYK
1896|chp|nrc1      VRLGTYLVAPY-PG---GETLFCKITGLEYVQAFESDDATEIHARR-AMRSDGVDEADYK
13396|hp|hma       LRIGTYLLVPY-PG---GERLFCRIKALEYAQEFHADDATEIHARR-AMRERGIDERDFK
625|gene|hhi       LRIGTYLLVPY-PG---GERLFCRIKALEYAQEFHADDATEIHARR-AMRERGIDERDFK
1379|chp|hut       VRIGTYLLAPY-PDSTTEERLFCRITALEYVREFRADDATEIHARR-AMRAEGIDEQDFK
5026|gene|nph      IRIGSYLVAAY-PD---GERLFCRIAALEYEREFRADDATEIHARR-AMRSDGIDEHDYK
                   :*:*.**  .* *     :  :..   :   . :     ::*: ..         * .:.

2787|hp|hla        YVAQIEPISIVEFDETDTENQ----------FTQATVDKPPKPGANTCLVEDRAFLRSAL
3070|gene|hwa      FVATLRPLAILFNETTNTTDTHDDVSDNIATLTRRMVDRVPKPGAIVRAATDAKQIKTGL
1979|gene|hla      FMAELEPMSVVYGTGDD--------------MKRRMTDRVPKPGAIVEEASDDAEIKTGL
7980|hp|hbo        FVASLDPVAVLFEQGDE--------------LKRRMVDRVPKPGAIVAEATDPEQIKTGL
1896|chp|nrc1      FLAELDPVAVLSDEGDD--------------ITRRMPDRVPKPETVVRAADDAAEIKAGL
13396|hp|hma       FIAELEPVAVLYSDGGE--------------LKRRMTDRVPKPETVVREATDKSEIKTGL
625|gene|hhi       FIAELEPVAVLYSDGGE--------------LKRRMTDRVPKPETVVREATDKSEIKTGL
1379|chp|hut       FMATLEPVAILYNDDGE--------------LQRRMTDRVPKPETPVSHADERSAIKTGL
5026|gene|nph      FMATLEPVAVLYEEDGD--------------LKRRMTDRVPKPETVVREAVDDTEIKTGL
                   ::* : *::::     :              : .   *. *** : .  . :   :.:.*

2787|hp|hla        RLPDRGVFLGHMAVSGDRIPTEEEP--LPYYMFNPNATDGNEDEGEPAIFRHTQVAGSTG
3070|gene|hwa      NIPRDGVFLGHLSVGGERVETAASPPTIDYRL------NDDYTSGDPLIFRHTLVAGGTG
1979|gene|hla      KIPEDGVFLGHLSVGGEKVRTAAEPPTVDYRV------KDDYADGDPLAFRHTLVAGGTG
7980|hp|hbo        KIPAEGVFLGHLSVGGEKVRTAAEPPTIDYRL------KDDYTDGDPLVFRHTLVAGGTG
1896|chp|nrc1      KIPADGVFLGHLSVGGEKVRTAADPPTIDYRV------KDGYEAGDPLVFRHTLIAGGTG
13396|hp|hma       KIPEDGVFLGHLAVGGEKVRTAAEPPTIDYRL------KDDYVAGDPLVFRHTLVAGGTG
625|gene|hhi       KIPEDGVFLGHLAVGGEKVRTAAEPPTIDYRL------KDDYDAGDPLVFRHTLVAGGTG
1379|chp|hut       KIPEDGVFLGHLSVGGEKVRTAAQPPTIDYRL------KDAYDAGDPLVFRHTLVAGGTG
5026|gene|nph      KIPEAGVFVGHLSVGGQKVKTAASPPTIDYRL------KDDDDAGDPLVFRHTLVAGGTG
                   .:*  ***:**::*.*:.: *  .*  : * :      ..    *:*  **** :**.**

2787|hp|hla        QGKTHGSKNILRN-LSTGKEYSIEVPPEEQDGENVDVVEDRQR--ALNVTVIDPEGEYVE
3070|gene|hwa      SGKTHASKNVLRQLLAEDRTYEMD--------------DGRSS--RLAVVQFDPQDEYAQ
1979|gene|hla      SGKTHASKNVLRQYLDADRTYPTG--------------DGRES--RMAVVQFDPQDEYAQ
7980|hp|hbo        SGKTHASKNLLRQLLDSDRTYEMD--------------DGRDA--RMAVVQFDPQDEYAQ
1896|chp|nrc1      SGKTHAAKNVLRQYLHEDRRYPVD-------------SGGPER--RMAVVQFDPQDEYAQ
13396|hp|hma       SGKTHSSKNVLRQYL--GRTYEMG--------------DGRTP--ELAVVQFDPQDEYAQ
625|gene|hhi       SGKTHSSKNVLRQYL--GRTYEMG--------------DGRTP--ELAVVQFDPQDEYAQ
1379|chp|hut       SGKTHLAKNVLRQFLAEERSYPVE--------------TGSDRTVSPAVVQFDPQDEYAQ
5026|gene|nph      SGKTHTAKNILRQYLAADRRYDIG--------------DGRER--APALVQFDPQDEYAQ
                   .**** :**:**: *   . *                  .        :. :**:.**.:

2787|hp|hla        MGDDPDPETQADYYEDEFQEMLEEQNILHGGLDSPDSNVDFGVYVPNINDTHPSHPNCTE
3070|gene|hwa      MHDD-NPAL-----DSETIRRYEREEISHGGHNDTIALVPKEEGVTYSGDTHRAEQ--VR
1979|gene|hla      MHDD-NPDL-----DADFARRLDREGIAYGGHDDTVALVPRAANATYPGEGHRAER--VE
7980|hp|hbo        MHDD-NPEM-----TESVARRYEREGVAHGGHDDTIALVPKEDGVPYGGDNHRAEQ--LE
1896|chp|nrc1      MHDD-NPDA-----DASDRRQWETQGLAYGGHDDTVAFVPTVGSASYAADHHAAEQ--VA
13396|hp|hma       MHDD-NPEM-----TDEFERRCEREGIAYGGHDDTIAFVPKVAGADYNASHHRAEQ--VE
625|gene|hhi       MHDD-NPAM-----TDEFERRCEREGVAYGGHDDTIAFVPKVAGADYNASHHRAEQ--VE
1379|chp|hut       MHDD--GDL-----SADFRRRCEREGIACGGHEDTVAFVPEVGGATYSAEHHRAEQ--VA
5026|gene|nph      LHDD-NPDI-----GTEFRRRLEREAIAHGGVDDTKAFVPAVDGTSYAASHHRAEQ--VE
                   : **            .     : : :  ** :.. : *     .    . * :      

2787|hp|hla        FSIPFELVRRNRQLLYKSSPPDRTKDAI-NDLITEYFHNHNAPYTYGEFSNFADNMLDED
3070|gene|hwa      FTIPFSMVRTRPWLVAGSRLNENQYPAL-RHLLNRFFDEYGNSGTYAGFKTFLENPALRE
1979|gene|hla      FTIPFSLAQDMPWLVAGSGLNENQYPAL-LTLLNRFFRDYGDSGTYSQFLSYLDDPALKE
7980|hp|hbo        FTIPFSMARDRPWLVAGSSLNENQFPAL-KELLRRFFRQYGDEGTYDEFLTFLDDPALKE
1896|chp|nrc1      FTVPFSMVRDNPWLVASSGLNDNQYGAL-HLLLDRFFGQYGESGTYREFCAFLDDPALKE
13396|hp|hma       FTIPFSLVHDNPWLIAGSSLNDNQYGALVNTLLPRFKREYGEGGTYSDFRTFLGDPALKE
625|gene|hhi       FTIPFSLVHDNPWLIAGSSLNDNQYGALVNTLLPRFEREYGTGGTYSDFRTFLGDPALKE
1379|chp|hut       FTIPFSLVYDNPWLIAGSGLNDNQYNALVSVLLKRFKKQYGREGTYDQFTSFLDDPALKE
5026|gene|nph      FSIPFSMVHDNPWLVAGSGLNDNQYNALVSVLLKRFKRQFGDGGTYEQFRSFLDDPALRE
                   *::**.:.    .*:  *   :.   *:   *:  :  :..   **  *  :  :    :

2787|hp|hla        EDRITENGSVKTAA----RERLVGQYEFNRVFDNGDQSLFDL--TSEMFSPGKVTIIPTD
3070|gene|hwa      E--LDESGRVHEATFDAVKRRVWGV--PDNIFDQSARPITEL--DHQLVRPGGLSVIPTY
1979|gene|hla      E--LDESGRIHEATFDAVKRRVRGV--PGGVFDQDAKPITEL--DHTLVRPGGLSVVPTY
7980|hp|hbo        E--LHESGRVHEATFDAVKRRVRGV--PNGVFDQSARPITEL--DHELVRPGGLTVIPTY
1896|chp|nrc1      E--LDESGRVHEATYEAVLRRVNGM--PNGLFDQDARSITALVEDREFVQPGRLSVVPTY
13396|hp|hma       E--LDEAGDVHEATFDAVKRRVQG---FGAVFDQDARPITDQ--ISQFVRDGGLTVIPTY
625|gene|hhi       E--LDEAGDVHEATFDAIKRRVQG---FGAVFDQDARPITDQ--ISQFVRDGGLTVIPTY
1379|chp|hut       E--LDETGRVHEATYDAVKRRALG---FGNVFDQDARPITDL--VHEFVRPGGLTVVPTY
5026|gene|nph      E--LDESGKVHEATFDAVRRRISG---FSHIFDGDARPITDL--VSEFVRPGGVTTVPTY
                   *  : * * :: *:      *  *    . :** . ..:        :.  * :: :** 

2787|hp|hla        HLRGS-TDRLVVSCLLAHVVTNKIGSDVEFPHIKGTPMLLSLDEAHEYLTTPSDLGSRSG
3070|gene|hwa      HLSSTRVKEMVVLAVSSLLVDDKLSNNPYSDRINETPLLIGMDEAHNFLTDADTVQARK-
1979|gene|hla      HLPTSRQKEIVVLAVAGLLVDDKLSNDPDSDRIEETPLLIGMDEAHNFLADADTVQAQK-
7980|hp|hbo        HLSTSRAKEMFVLAVSSMLIDDKLSNTPDSQRIKQTPLVLGMDEAHNFLADADNVQARK-
1896|chp|nrc1      HISNSRAAETVVLAVSSLLVDQKLSNDPRYDAIKRTPLLVGMDEAHNFLSDADSVQARK-
13396|hp|hma       HITDSRTASTIVLAVSSLLIDQKLSNDPDYDRIKETPLVLGMDEAHNFLTDADSVQGRK-
625|gene|hhi       HITDSRTASTIVLAVSSLLIDQKLSNDPDYDRIKETPLVLGMDEAHNFLTDADSVQGRK-
1379|chp|hut       HVNDSRATETVVLALSSLLVDEKLSNDPTYERIGETPLVVGMDEAHNFLTDADSVQARK-
5026|gene|nph      HINDSRATTTVVLAVASLIVDEKLSNDPTHDRIKETPLVLGMDEAHNFLTDADSVQADR-
                   *:  :     .* .: . :: :*:..      *  **:::.:****::*: .. : .   

2787|hp|hla        YLVRKFRQAAKRGRKDKFGLYIITQTPQDIDEDVRKQMNTRIYLGL-ERDVVESHDVFVP
3070|gene|hwa      -VISKFTEAAKQGRKERLGLFLITQDPQDIAESVFKQVNTKLILNLGDEDAINS--VNIP
1979|gene|hla      -VVQKFTEAAKQGRKERLGLFLITQDPQDVAESVFKQINTKVVLNLGDEDAISS--VNIP
7980|hp|hbo        -VVSKFTEAAKQGRKERLGLFLITQDPQGVAEPVFKQVNTKLVLNLGDEDAIKS--VNIP
1896|chp|nrc1      -VVGKFTEAAKQGRKERLGLFLITQDPQDIAGPVFKQVNTTVVLNLGDEDAIQA--VNIP
13396|hp|hma       -VIGKFTEAAKQGRKERLGLYLITQDPQDIADPVFKQINTTMVLNLGDEDAISA--VNIP
625|gene|hhi       -VIGKFTEAAKQGRKERLGLYLITQDPQDIADPVFKQINTTMVLNLGDEDAISA--VNIP
1379|chp|hut       -VIGKFTDAAKQGRKERLGLFLITQDPQDIADPVFKQINTTVVLNLGDEDAISA--VNIP
5026|gene|nph      -VIGKFAEAAKQGRKERLGLFLITQDPQDIADPIFKQINTTVVLNLGDEDAIKA--VNIP
                    :: ** :***.***:.:**::*** **.:   : **:** : *.* : *.:.:  * :*

2787|hp|hla        KEFKEAVTQFNKGQMVVKQPD-VRAVEIKGLPACLTHHSN-
3070|gene|hwa      AALENKVPYMKKGQQVIYSPDNSEPVEIQGLRHCLTRHGE-
1979|gene|hla      SNLAGKVPYMEKGQMVVYSPDNSEPVELIGLSKCVTRHGD-
7980|hp|hbo        PNLEDKVPYMEKGQMVVYSPDNSEPVELVGLSTCVTRHGE-
1896|chp|nrc1      ATLQSKVPYMNTGQMVVYSPDNSEPVEVQGLATCVTRHGRD
13396|hp|hma       SNLESKVPYMEKGQRVVYSPDNSEPVELIGLSTCVTRHGRD
625|gene|hhi       SNLESKVPYMEKGQRVVYSPDNSEPVELIGLSTCVTRHGRD
1379|chp|hut       SHLEAKVPYMEQGQLVVYSPDNSEPVELIGLPECVTRHGRD
5026|gene|nph      SNLEGKVPYMEQGQMVVYSPDNSEPVELRGLSNCLTRHGRD
                     :   *. :: ** *: .**   .**: **  *:*.*.