HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0024COG1233arCOG01521Phytoene dehydrogenase and related proteinsphytoene dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0024 nrc1 VNG1684 crtI1 phytoene dehydrogenase
cHOG0024 nrc1 VNG1755 crtI2 phytoene dehydrogenase
cHOG0024 hmu HMUK1684 Hmuk_1684 phytoene desaturase( EC:1.14.99.- )
cHOG0024 hmu HMUK1360 Hmuk_1360 phytoene desaturase( EC:1.14.99.- )
cHOG0024 hma RRNAC0321 crtI2 phytoene dehydrogenase
cHOG0024 hma RRNAC1902 crtI1 phytoene dehydrogenase
cHOG0024 hwa HQ1794A crtI phytoene dehydrogenase (phytoene desaturase)
cHOG0024 hwa HQ2863A crtI phytoene dehydrogenase (phytoene desaturase)
cHOG0024 hla HLAC1897 Hlac_1897 phytoene desaturase
cHOG0024 hbo HBOR10650 Hbor_10650 phytoene desaturase( EC:1.14.99.- )
cHOG0024 hut HUTA2373 Huta_2373 phytoene desaturase
cHOG0024 hut HUTA0318 Huta_0318 phytoene desaturase
cHOG0024 hvo HVO_2528 HVO_2528 crtI phytoene dehydrogenase
cHOG0024 nph NP0204A crtI_2 phytoene dehydrogenase 2 (phytoene desaturase)
cHOG0024 nph NP4764A crtI_1 phytoene dehydrogenase 1 (phytoene desaturase)
cHOG0024 hhi 2514 crtI3 phytoene dehydrogenase
cHOG0024 hhi 2415 crtI2 phytoene dehydrogenase
cHOG0024 hhi 1058 crtI1 phytoene dehydrogenase
MUSCLE (3.6) multiple sequence alignment


2514|gene|hhi       --------------------MGTESA-DVAVIGGGVAGMSTAARLQADGYSTVVLEQHHS
1794|gene|hwa       --MSISPISPSASLEKHSMTHTLSET-STIVIGGGFSGLSTACYLADAGVDVTILERQDT
204|gene|nph        ---------MPATDTTQHARCPLDGQ-SATVVGGGFGGLAAACHLAADGAEVRLLEQHDR
318|gene|hut        --------------MTGNAAGSLAGR-SVDVIGGGIGGLSAAAFLADAGADVTVLEKQPR
1755|gene|nrc1      MPHQSQPGFLLPAIQHHSMQGSLPGERDVTVVGGGFGGLAAAAYLARAGASVTLLEQHDT
11902|gene|hma      ------------------MRDGLPRDLTVTVVGGGFGGLSAACYLANAGADVQLLERYDR
2415|gene|hhi       ------------------MRDGLPRDRTVTVVGGGFGGLSAACYLADAGADVRLLERHDR
2373|gene|hut       -------------------MTSSTDF-DVTIVGGGFGGLSAACHLADAGVDVTIVEKNEA
1684|gene|nrc1      -------------------MDELAGT-SVAVIGAGFGGLSTACYLADAGADVTVVEKTDQ
10321|gene|hma      -------------------MSDLSGE-DVTVVGGGIGGLSAACYLADADANVSLLEKNEQ
1058|gene|hhi       -------------------MSDLSGE-DVTVVGGGIGGLSAACYLADAGADVSLLEKNEQ
2863|gene|hwa       -------------MNTVSDLSDVDGS-SVVVIGGGFGGLSTACYLSDAGADVTVLEKNEQ
10650|gene|hbo      -------------MNAVSDLSVLDGT-SVVVVGGGFGGLSTACYLADAGATVTVLEKNEQ
4764|gene|nph       ---------------------MSSTR-SVVVVGSGFGGLSAACYLADAGLDVTVLEKNEQ
1897|gene|hla       -------------MDVAPDIDAVAGE-SVVVIGGGFGGLSTACYLADAGADVTLLEKNEQ
                                                . ::*.*..*:::*. *   .  . ::*.   

2514|gene|hhi       VGGCAGYYERAGFRFDVGATTLVDFVTGGVGGQLLSTVGFESPP---MERQDA-YDVWLP
1794|gene|hwa       LGGVAGRIERSGFQFDTGPSW---YLMPDVFERFFNELGYDPTEYYSLTRLDPNYRVFWK
204|gene|nph        LGGVAGRIETDGFRIDTGPSW---YLMPGAFERFFGHFDREPSAFYDLERLDPHYRVFWK
318|gene|hut        LGGAANLLETDGFRFDTGPSW---YLMPDVFERFFDQFDRVPEEYYTLQKLDPQYRVFFR
1755|gene|nrc1      VGGRAGVLERDGFRFDTGPSW---YLMPDVFERFFDHFDHDPHDFYELTRLDPQYRVFWT
11902|gene|hma      LGGHAGVLERDGFRFDTGPSW---YLMPDVFERFFKHFDREPADYYELERLDPQYRVFWK
2415|gene|hhi       LGGHAGVLERDGFRFDTGPSW---YLMPDVFERFFGHFDREPADYYELERLDPQYRVFWK
2373|gene|hut       VGGRASRLERDGFVFDMGPSW---YLMPEVFERFFEHFGHEPEDYYELERLDPHYRIFFK
1684|gene|nrc1      IGGRASTLERDGFRFDMGPSW---YLMPDVFEEFFASFDSHPSDYYGLTRLDPHYRIFFK
10321|gene|hma      LGGRASRLEVDGFRFDMGPSW---YLMPDVFERFFAYFGKEPRDYYDLQRLDPHYRVFFK
1058|gene|hhi       LGGRASRLEVDGFRFDMGPSW---YLMPDVFERFFAYFGKEPRDYYDLQRLDPHYRIFFK
2863|gene|hwa       LGGRASRLEVDGFKFDMGPSW---YLMPDVFERFFNYFDREPSEYYELTRLDPHYRIFFK
10650|gene|hbo      LGGRASRLERDGFRFDMGPSW---YLMPDVFEDFFGYFDRTPSDYYELTRLDPHYRIFFK
4764|gene|nph       LGGRASVLETEGFRFDMGPSW---YLMPDVFERFFDHFDREPGDFYKLERLDPHYRIFWK
1897|gene|hla       LGGRASRLEADGFRFDMGPSW---YLMPDVFERFFGHFGREPSEFYELERLDPHYRVFWK
                    :** *.  *  ** :* *.:    ::   .   ::  ..  .     : . *. * ::  

2514|gene|hhi       -----DRTVTLYRDQTDWDAERRTKLGDDKRHLAFYDFIDDLSARLWR--LTRTDVKMPI
1794|gene|hwa       ------------------DGDTAILPADREGQRELFEQYESGAGAALDTYLEQAADAYEI
204|gene|nph        ------------------DGDRVDVPDDPEAVAELFERYEPGAGNAFRAYLDSAEHAYEV
318|gene|hut        DSEPVPGAGTPYDEDVDAPCDWVTVTPDRNQIKRIFAAYEAGGGEAFEEYLAEAEHTYDV
1755|gene|nrc1      ------------------DGDSATIEPNRRNAHELFESYEEGAGDALATYLDRAATNYDL
11902|gene|hma      ------------------DGDRVTMRPNRENAREVFESYEEGAGDALAEYLDRAEQNYDL
2415|gene|hhi       ------------------DGDRVTMRPNRENAREVFESYEEGAGDALAEYLDRAEQNYEL
2373|gene|hut       DNEAGSASERSSGQALQAGSDVVDISANRNENRELFESYEDGAGEAFDAYLTTSQRHYEM
1684|gene|nrc1      DNEGRRPGRDAPGLNVDTDGDTIDVTPDREQVKQVFDAYEPGAGDVLDDYLAQAKENYEV
10321|gene|hma      ------------------DGDQIDVTGDNDQMAQKFEEYEPGAGEAFRDYLATSERHYET
1058|gene|hhi       ------------------DGDRIDVTGDNAEMARKFEEYEPGAGEAFEDYLATSERHYET
2863|gene|hwa       ------------------DGDRVEMVPDREQNREVFESYEPGAGDRFDEYLAKSKKNYEV
10650|gene|hbo      ------------------DGDRVDMVPDLEQNRETFEAYEPGAGKQFEKYLQKAEKNYEV
4764|gene|nph       ------------------DGDTAAVTDDREEMRKLFEEYESGAGEALDSYLATSRDHYEF
1897|gene|hla       ------------------DGDKVDVLPDREANKALFEEYEPGAGEAFEAYLEESERTYEI
                                        :      :       :   :  ..      *  :      

2514|gene|hhi       RSVGDLVRNARAVGLRDLPLARYLRWT-----MADAMRAHG--VYDDRPLRAVVSMLVED
1794|gene|hwa       -GMEEFVYKHRP-RFRDWVDPGLLRAA-RGITLVGSMDDHIASYFDSAKLRQLLEYTLV-
204|gene|nph        -GVDEFVYEDRS-RVRDCLDPRLLRAV-RGLTLLSSMDEYVADYFENPKLRQLVQYTLV-
318|gene|hut        -GMEHFVYEDRS-RFRDLLDRDVVAAG-PGLTMLGSMQGHVENYFDNPKLQQLLQYTLV-
1755|gene|nrc1      -AMNRVVYPDRT-AFRDYASTDMLPLA-SRLRLFGNMDDYVSRFFDHPKLRQLLEYTLV-
11902|gene|hma      -AMDRVVYEGRE-RLRDYVDPDLLPLA-PRARLFGSMDDYVSRYIDHPKLRQLLEYTLV-
2415|gene|hhi       -AMNRVVYEGRE-RLRDYVDTDLLPLA-PRARLFGSMDDYVGRYIDHPKLRQLLEYTLV-
2373|gene|hut       -SMENFVYEYRP-SWKDWIDPSLMKTGTLGLKLFQSMQGHVEDYFENEKLQQIVQYTLV-
1684|gene|nrc1      -GMEHFVKTDRP-RVRDWMDPKLAEYA-RGLTLLGSMQDHVEQYFDHPKLQQVMQYTLV-
10321|gene|hma      -AMNKFVYEDRS-ELRDWVDLDVMTAAPVGLQLIGTMQSHVEDYFEHPKLQQIMQYTLV-
1058|gene|hhi       -AMNKFVYEDRS-ELRDWIDLDVMTAAPVGLQLIGTMQSHVEDYFEHPKLQQIMQYTLV-
2863|gene|hwa       -GMEHFVYEDRA-ELSDYADWDVMKNA-RGLSLIGSMQDHVEQYFDHPKLQQIMQYTLV-
10650|gene|hbo      -GMEHFVYTDRT-KLSDFADWDVIKNA-RGLSLIGSMQDHVEKYFDHPKLQQIMQYTLV-
4764|gene|nph       -GMETFVYEDRP-RLRDWVALDVMRAAPVGLKLLGTMDDYVADYFDDPKLRQIMQYSLV-
1897|gene|hla       -GMEHFVYEDRP-RLRDYVDKDVLRYS-WGLSLLGKMQGHVEDYFDHPKLQQLMQYTLV-
                     .:  .*   *     *               :   *  :     :   *. ::.  :  

2514|gene|hhi       TVHATLDDAPLLNAVLGMTIRRTGLGRAT------GGMYGFWESFVDQYTDIGGRVETGR
1794|gene|hwa       FLGGSPYNTPALYSLMSHVDFNMGVYYPR------GGIASVVDSIATIAHELGVNIETNT
204|gene|nph        FLGGAPHNTPAIYTLMSHVDFNLGVYHPT------GGIASVVDGVAELARDLGVDIETGT
318|gene|hut        FLGGSPHNTPALYNLMSHVDYNMGVYYPE------GGMYSLVEGLAELGEELGVTYRTDV
1755|gene|nrc1      FLGGAPHNTPALYSIMSHVDLNGNVFYPE------GGIAGVVDALAELAVEQGATIETGV
11902|gene|hma      FLGGAPHNTPALYSIMSHVDLNMNVFYPE------GGIAGVVDGLGSLARELGVDIQTGT
2415|gene|hhi       FLGGAPHNTPALYSIMSHVDLNMNVFYPE------GGIAGVVDSLGSLARELGVDVQTGT
2373|gene|hut       FLGGSPSNTPAIYNMMSHADFNLGVYYPQPVDGGPGGIGAVVDAIVDLAEELGVTIETDT
1684|gene|nrc1      FLGGSPDTTPALYNLMSHVDFGLGVYYPE------GGMGGVVDGITALARELGVEFRTGH
10321|gene|hma      FLGGSPRTTPALYNMMSHVDFNLGVYYPD------GGVGAVVDGLVELGEELGVTYETDA
1058|gene|hhi       FLGGSPRTTPALYNMMSHVDFNLGVYYPD------GGVGAVVDGLVELGEELGVTYETDA
2863|gene|hwa       FLGGAPTNTPALYNLMSHVDFNMGVYYPE------NGVGGVVDGIVELADELGVTFHTNA
10650|gene|hbo      FLGGAPNNTPALYNLMSHVDFNMGVYYPD------GGLGGVVDGMVSLGEELGVEFRVES
4764|gene|nph       FLGGAPNNTPAIYNMMSHVDFNLGVYYPE------NGLRSVVDACVELGEELGVEYVTDA
1897|gene|hla       FLGGSPTNTPALYNLMSHVDYNMGVYYPE------GGIGAVVDGIVELGEDLGVEFVTDA
                     : .:   :* :  ::. .    .:  .       .*: .. :.      : *    .  

2514|gene|hhi       TVTAVTG--SNSGFRVDSAAGP-VHADQVVSTV-PVPVTRSLAPTVVGDRLDDYCSMLQA
1794|gene|hwa       PVTGLSRAHSDTGVRVQTSADT-HIADRVVSTVPVAHTDRELLSDGVSDHDGSYWES-RT
204|gene|nph        PVSGLDP--ADNAITVSTDAGT-HRADTVVANAAPAHVDRDLLPDGVAEYGDDYWSD-RT
318|gene|hut        EVTDIQE--TITGLALQTTAGR-RRADRVVANAPPAHVERELLSPGKRDHDLDHWDD-QT
1755|gene|nrc1      GVNAISG--RRGEFTLATDDGT-RTTDLVVNNANPAYAERELLDTGGRDHAPDYWDD-QT
11902|gene|hma      EVQHIAG--EAGAFELTTEDGV-VASDVVVSNANPAYTEQHLLDPAARDHDPDHWDE-QT
2415|gene|hhi       EVQHIAG--EAGAFELTTKDGV-VGSDIVVSNANPAYTEQHLLDPAARDHDTEYWDD-QT
2373|gene|hut       EVTEITR--RKDGFLLETADGDQRRPDVVVANADYAHAEQDLMPAHERQYDAGYWDD-RT
1684|gene|nrc1      PVSAIKG--RRGGFKLDTEPGDAVLADVVVSDADYAHTEQALLPAQKRQYDADYWDA-RT
10321|gene|hma      EVNEISR--RKDGFLVETVHGDTTHPDEVVVNADYGHAERELLPDHERQYDDDYWDD-KT
1058|gene|hhi       EVDEISR--RKDGFLVETVHGDTTHPDEVVVNADYGHAERELLPDHERQYDDDYWDD-KT
2863|gene|hwa       PVSEIRG--REGAFVTRTETDAEFYSESVVSNADYRHTEMELLPPEKRQYDPDYWDS-RT
10650|gene|hbo      PVNEIRG--REEAFVTRTEDGREFYSDYVVSDADYRHTEMDLLPEGKRQYDEDYWQS-RT
4764|gene|nph       EVTEIVN--RKDGFTVESSAGD-FDADRVVSNADYAHTEQELLPEHERQYDAEYWDS-RT
1897|gene|hla       EVTAIEG--RRGGFALDTADGERYLTDLVVSDADYAHTEQELLPKHKRQYSDEYWES-RT
                     *  :        .   :  .    .: **  .    .   *      :    : .  .:

2514|gene|hhi       HEGSALVLFLGVPAAEVDSRERTHHQIL----------QAYDEP-LGNGNNMFVSVSAPG
1794|gene|hwa       YAPGAFLLYLGV---EGKLDSLEHHTLILPTDWQSHFESIFDDPTWPTDPSYYVNVPSQT
204|gene|nph        YAPSAFMLYLGV---EGDVEPLYHHTLVLPTDWDDHFRQIFETPAWPDDPAYYINVPSST
318|gene|hut        YAPSALLWYFGV---EGDVGPLEHHSLVFPDDWDPHFASIFEEPGWPDDPAYYLSVPSIT
1755|gene|nrc1      YAPSALMFYLGV---EGDVEPLAHHSLVLPPDWDGHFAQLFDDPGWPDDPAFYLSVASKT
11902|gene|hma      YAPSAFMLYLGV---EGDVDPLAHHSLVLPTDWDGHFEQIFDRPGWPDDPAYYLSVASKT
2415|gene|hhi       YAPSAFMLYLGV---EGDVEPLAHHSLVLPTDWDGHFEQIFDRPAWPDDPAYYLSVTSKT
2373|gene|hut       YAPSAFLLYLGV---EGEVPELEHHSLVFPTDWGEYFDDIFEDPAWPEDPSYYLCVPSKT
1684|gene|nrc1      YAPSAFLLYLGV---EGDVEPLAHHTLVLPSDWDTHFAQIFDDPAWPDDPAYYLCVPSKT
10321|gene|hma      YAPSAFLMYMGV---EGDVEPLKHHTLVLPTDWDPHFDDIFDEPAWPDDPAYYLCVPSKT
1058|gene|hhi       YAPSAFLMYMGV---EGDVEPLKHHTLVLPTDWDPHFDDIFDEPAWPDDPAYYLCVPSKT
2863|gene|hwa       YAPSAFLLYLGV---EGDVGDLAHHSLVLPTDWDDHFEQIFDDPAWPADPAYYLCVPSQT
10650|gene|hbo      YAPSAYLLYLGV---EGDVPELEHHTLVLPTDWDDHFEKIFDDPAWPDDPAYYLCVPSKT
4764|gene|nph       YSPSAFLLYLGV---EGDVEPLEHHTLVLPTDWDGHFEQIFDTPAWPDDPAYYLCVPSKT
1897|gene|hla       YAPSAFLLYLGV---EGDVPNLEHHTLVLPTGWNHHFEQIFDDPAWPDDPAYYLCAPSET
                    :  .* : ::**   * .     ** ::          . :: *    .   :: ..:  

2514|gene|hhi       DDVSAPAGHRAVMLSTHCAVEPWQGLDEAAYGEQKAAAREQLLAG-GRTVYPDLGTDPVV
1794|gene|hwa       DSTVAPDGHSTVVILVPIA----PGLDDSD--AIRERYREKVLTDLAVHTGIDLRDRIVV
204|gene|nph        DPTMAPDGHEAVVVLVPIA----PGLDDGP--AVRETFREQVLNDIATHTGVDLRDRIVL
318|gene|hut        DDGVAPEDHHAVVVLIPIA----AGLEDSD--ERRQEYRDWVLDDLATNIGVDLRDRIVT
1755|gene|nrc1      DDTVAPDGHEAVVILLPIA----PGLDDTP--EIRAQYRDRLLGTLAAQTGVDLRDRIVV
11902|gene|hma      DETVAPDGHHAIVVLVPIA----PGLDDGP--AIREEYRAFVLDDLAEQTGVDLRDRIVV
2415|gene|hhi       DETVAPDDHHAVVVLVPIA----PGLNDGP--DIRKEYREFVLDDLAKQTGVDLRDRIVV
2373|gene|hut       DDDVAPEGHTNLFALVPIA----TELDDPQ--ETRDRYRDKIIADIAENTGVELEDRIVV
1684|gene|nrc1      DDTVAPDGHSNLFALVPVA----PGLDDTP--AVRESYRDLVLDDIAENTGVDLRDRIVV
10321|gene|hma      DDTVAPDGHSNLFVLVPIA----PGLHDGD--EIREEYREKVLADIADNTGVDLRDRIVY
1058|gene|hhi       DDTVAPDGHSNLFVLVPIA----PGLHDGD--EIREEYREKVLADIADNTGVDLRDRIVY
2863|gene|hwa       DDDVAPDGHSNLFALVPIA----AGLDDSE--EHRQRYRNLILDDIAEHTGVDLRDRIVV
10650|gene|hbo      DDTVAPEGHSNLFVLVPIA----AGLDDTP--EQRERYRDLVLDDIAAHTGEDLRDRIVL
4764|gene|nph       DDSVAPEGHSNLFALVPVA----PGLDDDA--ETRAWYRDLVLDDIAENTGVDLHDRIVF
1897|gene|hla       DDTVAPEGHSNLFALVPIA----PGLEDTP--ELREEYRDLVLDDIAENTDTELRDRIVF
                    *   ** .*  :.     *      * :      .   *  ::   .     :*    * 

2514|gene|hhi       SEVATPVTYEQFTKRPRGAVGGYKQTRANANQGAVPQN-IGIEGFYLAGDTTWPGLGTVA
1794|gene|hwa       EETACTSEFAA-MGYPDGTALGLAHTLTQTGPFRPAHRSDAVSRLYHAGSFTDPGIGMPM
204|gene|nph        ERTACVSEFGQRFGAPQGTALGLAHTLSQTGPLRPSIRSSVSDSLFYAGSYTSPGIGVPM
318|gene|hut        AASMCVDDFTERLHYPEGTALGLAHTLFQTGPMRPSHRAKQVDGLYYVGGFTSPGIGVPM
1755|gene|nrc1      EESACVSEFSEQFGDPGGTALGLAHTLFQTGPLRPGKR-DGPDGHYYVGAYTNPGIGMPM
11902|gene|hma      EETACVSEFAERYGDPQGTALGLAHTLFQTGPLRPSHR-AGLEGLYYTGAYTTPGIGMPM
2415|gene|hhi       EESACVSEFAERFGDPQGTALGLAHTLFQTGPLRPGHR-AGLEGLYYTGAYTTPGIGMPM
2373|gene|hut       EEQFSISEFADRYNATKGTAMGLAHTLRQTAMLRPPIESSAVDDLYFTGGYSTPGVGVPM
1684|gene|nrc1      EERFSVSEFADRYNSHQGTALGLAHTLRQTALFRPPHRSTALDGLYFTGANTTPGIGVPM
10321|gene|hma      EKQFAVSDFGERYNATEGTALGLAHTLRQTALLRPNNRSSAVDGLYFTGSFTTPGIGVPM
1058|gene|hhi       EKQFAVSDFGERYNATEGTALGLAHTLRQTALLRPNNRSSAVDGLYFTGSFTTPGIGVPM
2863|gene|hwa       ERSFCVDDFADRYNSTAGTALGLAHTLEQTALLRPGHHSSAVDGLYFTGSFTTPGIGVPM
10650|gene|hbo      EESFCVDDFSDRYNATQGTALGLAHTLRQTALLRPPHHSEEVSGLYFTGSFTTPGIGVPM
4764|gene|nph       EETFTVSEFADRYNSTQGTALGLAHTLRQTALLRPPHRSDACPGLYFTGAFTTPGIGVPM
1897|gene|hla       EETFCVDDFADRYNSYQGSALGLAHTLRQTSLLRPPHRSDALDGLYFTGSTTTPGIGVPM
                            :        *:. *  :*  ::               : .*  : **:*   

2514|gene|hhi       CVKGSKIAADHVRR---------------------------
1794|gene|hwa       CLINGKHVASAVVRDIKNDRATSRISSVSSVVSQAFGFD--
204|gene|nph        CLTSGEHAAAAVRADATGGLFSGR-----------------
318|gene|hut        TIISGEHAAEAVIEDERERGIKARFLG--------------
1755|gene|nrc1      CLISGEHVTKAVIDDDPAASGSTDPLAVPGEFNFDTPTTAD
11902|gene|hma      CLISGEHTARDIVEDSPFETKGDRSASTAD-----------
2415|gene|hhi       CLISGEHTARDIIEDSPFETKQDRSASTAD-----------
2373|gene|hut       CLISGEHAAEAVLENSR------------------------
1684|gene|nrc1      CLISGEVTANNVLADAR------------------------
10321|gene|hma      CLISGEHTAEALIEDIA------------------------
1058|gene|hhi       CLISGEHTAEALIEDIA------------------------
2863|gene|hwa       CLISGQLTAEKMADRAT------------------------
10650|gene|hbo      CLISGQLTAEKMAERMA------------------------
4764|gene|nph       CLISGEHTAEALLNDAR------------------------
1897|gene|hla       CLISGQLTAEELSKTA-------------------------
                     : ..: .:  :