HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0239COG0152KOG2835arCOG04421Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthasephosphoribosylaminoimidazole-succinocarboxamide synthase

HOG Organism Gene ID Name Annotation
cHOG0239 nrc1 VNG1939 purC phosphoribosylaminoimidazole-succinocarboxamide synthase
cHOG0239 hmu HMUK1420 Hmuk_1420 SAICAR synthetase( EC:6.3.2.6 )
cHOG0239 hma RRNAC3275 hemH phosphoribosylaminoimidazole-succinocarboxamide synthase
cHOG0239 hwa HQ3128A purC phosphoribosylaminoimidazole-succinocarboxamide synthase
cHOG0239 hla HLAC1700 Hlac_1700 SAICAR synthetase
cHOG0239 hbo HBOR06310 Hbor_06310 phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase( EC:6.3.2.6 )
cHOG0239 hut HUTA2216 Huta_2216 SAICAR synthetase
cHOG0239 hvo HVO_2193 HVO_2193 purC phosphoribosylaminoimidazole-succinocarboxamide synthas
cHOG0239 nph NP4996A hemH phosphoribosylaminoimidazole-succinocarboxamide synthase
cHOG0239 hhi 517 purC phosphoribosylaminoimidazole-succinocarboxamide synthase
MUSCLE (3.6) multiple sequence alignment


1939|gene|nrc1      MGWGPRHSGMASVKDRRVESPATDTDLGRGVFEFSDRYSVFDWGEMPDHVPGKGASLCTM
3128|gene|hwa       ---------MTSVKEFLIETEPTTTGYGRGRFVFTDQYSVFDWGAMPDQIPHKGTSLCTM
6310|gene|hbo       ---------MTSVKEFRVETDPTADELGRGRFVFTNQYSVFDWGEMPDHVPKKGASLCTM
1700|gene|hla       ---------MTSVKEFRVDEPATADSLGRGRFVFTDAYSVFDWGQMPDAIPRKGASLCAM
13275|gene|hma      ---------MTSVKEFRVDEPATAEGLGRGAFVFTDDYSVFDWGKMPDQIPDKGASLCTM
517|gene|hhi        ---------MTSVKEFRVDEPATAEDLGRGAFVFTDDYSVFDWGKMPDRIPDKGASLCTM
4996|gene|nph       ---------MTSVKEFRIEEPATETDLGAGAFVFTDDYSVFDWGKMPDSIPNKGASLCAM
2216|gene|hut       ---------MTSVKEFRIDDEPTATDLGRGAFVFTDDYSVFDWGKMPDEIPGKGAALCTM
                             *:***:  ::  .*    * * * *:: ******* *** :* **::**:*

1939|gene|nrc1      GAYTFEQLAAAGVPTHYQGVRTP--------DGET--VRLADA---P--------EAPTQ
3128|gene|hwa       GAYNFELLEENGISTHYIGVVRPSKAETTTIDNQS--SDESDHITTDPCSLDACSTAPTE
6310|gene|hbo       GAFNFELLEVNDIPTHYVGVIE---------DGET--TDLKEC---E--------SPPTE
1700|gene|hla       GAFNFELLEDEGIPTHYRGVADPGRDVDAGEEGETGIVPLADA---T--------APPTE
13275|gene|hma      GAYNFQLLEENHVPTHYEGVRLP-------DSDEV--RDLGEALSAD--------AAPEE
517|gene|hhi        GAYNFQLLEENHVPTHYEGVRLP-------DSDEV--LDLGEALSAD--------AAPEE
4996|gene|nph       GAANFERLEAEGIPTHYRGVVS---------GGEV--VALSEA---V--------SPPRE
2216|gene|hut       GAANFEALEDDGIPTHYEGVVV---------DGEP--VSIETAIDAG--------AQPRE
                    ** .*: *    :.*** **            .:                       * :

1939|gene|nrc1      MVIDLTQVPTLPFED--G--SYDYDRYHDAGGSNYLVPLEVVFRNAVPVGSSLRTRCAPA
3128|gene|hwa       MAIKLTQVPALPYDD--G--AYDYESYHEAGGQNYLIPLEVVFRNSVPIGSSLRDRKSPQ
6310|gene|hbo       MVIELTQVPDLPYVGGSGADAYDYDAYHEAADENYLIPLEIVFRNTVPVGSSLRTRGEPA
1700|gene|hla       MAIDLTQVPDLPYEDPEA--GYDYDAFHAAGGENYLVPLEVVFRNRVPVGSSLRRRADPA
13275|gene|hma      MVIELTQVPDLPFED--G--SYDYDAYHAGADENYLIPLEIVFRNRVGVGSSLRSRTEPA
517|gene|hhi        MVIELTQVPDLPFED--G--RYDYDAYHGAADENYLIPLEIVFRNRVGVGSSLRSRTEPA
4996|gene|nph       MAIELTQVPDLPHDG--R--EYDYEAFHADAGENYLIPLEIVFRNTVPVGSSLRSRADPE
2216|gene|hut       MAIELTQVPDLPHDA--D--GYDYDAYHDGAGENYLIPLEIVFRNTVPVGSSLRKRSEPE
                    *.*.***** **.        ***: :*  ...***:***:**** * :***** *  * 

1939|gene|nrc1      DVGI------DADEWPQGPVELPETIVEFSTKYEEQDRYLSRSMADEIAGDADIAELDAL
3128|gene|hwa       EYDI------DADAWPSNPVELPKPVIEFSTKYEEQDRYLDREEAERIAGAASIDTLEEL
6310|gene|hbo       DYGL------DADAWPDEAVSLPEPVVEFSTKYEEQDRYLDREEAESIAGRAELDRLEEL
1700|gene|hla       DFGLDADPDIDADEWPDGPVDLPEPVVEFSTKYEQQDRYLTRAEADQIAGRADIDALESL
13275|gene|hma      DHGL------DYDTWPEEVVDLDEPIVEFSTKYEEQDRYLDREAADRIAGAASIDRLEEL
517|gene|hhi        DHGL------DYDTWPEEVVDLDEPIVEFSTKYEEQDRYLDREAADRIAGTASIDRLEEL
4996|gene|nph       AFGL------DYEEWPDEPVDLPEPVVEFSTKFEESDRYLSRSNADYIAGKADIDDLESV
2216|gene|hut       DHGL------DWESWPEEPVELPEPVVEFSTKYEEQDRYLTRAEADRIAGRANVADLESV
                      .:      * : **.  *.* :.::*****:*:.**** *  *: *** *.:  *: :

1939|gene|nrc1      ARRVNETITDCAADAGFVHDDGKLECVYVDGEVRVADVAGTFDENRFRFDGREVSKEAVR
3128|gene|hwa       AVSVNRIITREAEKRGFVHEDGKIECLYHDGEIILADVVGTFDENRFGYNDQEVSKEVIR
6310|gene|hbo       ALSVNHILNERAERAGFTHEDGKIECLYHDGTIKVADVVGTFDENRFSYDGQEVSKEVVR
1700|gene|hla       ARDVNRVVTERAEAAGFVHEDGKIECLYTDGELRVADVVGTFDENRFSYGGRGISKEVVR
13275|gene|hma      ARAVNHIVTEQAAEANLIHEDGKIECLYYDGEIRVADVVGTFDENRFSYEGQQVSKEVIR
517|gene|hhi        ARAVNHIVTQQAAEADLVHEDGKIECLYYDGEIRVADVVGTFDENRFSYGGQQVSKEVIR
4996|gene|nph       ARDVNTIVTETAAEAGLKHEDGKIECLYFDGEIRVADVVGTFDENRFSHDGQQLSKEVVR
2216|gene|hut       AREVNDLLNRQAVEAGFVHEDGKIECLYYEGEIRVADVVGTFDENRFSYDGQEVSKEVIR
                    *  **  :.  *   .: *:***:**:* :* : :***.******** . .. :***.:*

1939|gene|nrc1      QFYKRSDPEWVGAVKDAKRAADERGVADWKSLCEPSPDPLPPEILQAAADLYAAGANRYT
3128|gene|hwa       QQYKQIDPEWVSAVTDAKRQAKIQDVADWRGHCDRSPTPLPQPFINTISDLYAAGTNAYV
6310|gene|hbo       QYYKRTDPEWVEAVSEAKDRSREEGVADWRTLCEKSPDNLPASVLTAVSEMYAAGTNGYT
1700|gene|hla       QWYKANDPAWVEAVTEAKTAVADRDIDDWRELCERDPEPLPQAVVDAVSELYAAGTNAYT
13275|gene|hma      QYHKRTQPEWVEAVGEAKNEADVEGVADWKALCDESPEPLDDDVIKVARDLYCAGTNAYV
517|gene|hhi        QYHKRTQPEWVEAVSEAKEQADAESVADWKSLCAESPEPLDEDVIQVARDLYCAGTNAYI
4996|gene|nph       QYHKRTQSEWVEAVGEAKERAKAEDVADWRELCETEPEPLDDHVIDAVRDMYTAGTNAYI
2216|gene|hut       QYHKRTQSAWVEAVGEAKTRASEAGIADWKSLCDREPEPLDQHVIDVARDLYCAGTNAYL
                    * :*  :. ** ** :**      .: **.  *  .*  *   .: .  ::* **:* * 

1939|gene|nrc1      AREWFDAPPLGDALDAFE--
3128|gene|hwa       DTQWFDAPSIEMAIENIQEF
6310|gene|hbo       DSEWFDAPTIEDAVERVRGL
1700|gene|hla       DREWFDVPDIEAALDTVDGL
13275|gene|hma      GGDVFDAPSLDNAVDAASEL
517|gene|hhi        GGDVFDAPSLDEAVSAAGEL
4996|gene|nph       DRELFSAPPLSEAVETVRKL
2216|gene|hut       DRDVFEAPSIDDAIDAARSL
                      : *..* :  *:.