HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0238arCOG02260hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0238 nrc1 VNG1874 vng1874 no entry
tucHOG0238 hmu HMUK1502 Hmuk_1502 conserved hypothetical protein
tucHOG0238 hma RRNAC3414 hypothetical protein
tucHOG0238 hwa HQ3214A hypothetical protein
tucHOG0238 hla HLAC2306 Hlac_2306 hypothetical protein
tucHOG0238 hbo HBOR09950 Hbor_09950 hypothetical protein
tucHOG0238 hut HUTA0279 Huta_0279 conserved hypothetical protein
tucHOG0238 hvo HVO_2584 HVO_2584 pNRC100 replication protein H-like
tucHOG0238 nph NP2428A hypothetical protein
tucHOG0238 hhi 642 HAH_0642 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


3214|hp|hwa        -MYAVVGCTNCSAMWLLSDAHTAESATCPRCGRTHQTKKLRHFVEESDREAARQARSALL
2306|hp|hla        -MYAVVGCNECAAMWLLMDPQTSDSARCPRCGKTHQTTKLKRFFESEDREAAREARAALL
9950|hp|hbo        -MYAVVGCSECGSMWLLTDPRQSKTANCPRCGRTHQTKKLRKFLETEDREAARQARAALL
2584|gene|hvo      -MYAVVGCTDCANMWLLSDPDGSKTATCPRCGRRHQTKKLRRFFESDDRDAARQARSALL
2428|hp|nph        -MYTVVGCPACRAIWVVED--RPETTECRRCGKRHRFGKLRSFAQTDTADAAARVRSSML
1874|chp|nrc1      MSYAVVGCSDCNALWVVAG--RPETTSCPRCETRHQFGTLKQFVTTDDEDHAREVRASIL
279|chp|hut        -MYSVVGCTDCSALWVIEG--RPETSQCPRCGKRRQFDLLRKFAQTETADAARQARAAML
13414|hp|hma       -MYAVVGCSECSALWVTEG--RPETTQCPRCGTRRKHEKRRKFVETDDEAHAREVRASML
642|hp|hhi         -MYAVVGCSDCSALWVTEG--RPETTQCPRCGTRRKHEKRRKFVETDDEAHAREVRASML
                     *:****  *  :*:  .   ..:: * **   ..    . *   .    *  .*:::*

3214|hp|hwa        AKRDGNSAAFADTAHVAKMERTLADDTQQVSDNEYLSGVGINPDAVENAAQSDDATR---
2306|hp|hla        AKKRDESAAFAELDHVSELERAV--DESGIDDREYLEASGIDADAVDEAGARAEGGE---
9950|hp|hbo        AKKHGDSEAFAKTAHISEMESLV--EESGIDDAEYLEASGLDADEVASAGEQAMQGQ---
2584|gene|hvo      AKKHGDSEAFAQVEHVSELDRRV--EESGVDDREYLEGSGLDADEVFEAGEAAARGRDSS
2428|hp|nph        ADRADDGA-FVDPQTI-----DI--EGVGIDDATFLSASGVDPDAVADAGETDTSGS---
1874|chp|nrc1      ANKAGYGEAFADMDGFTALGEDA--MAAGIDDDDYLDAAGVDAAEAAAAGERA-EGT---
279|chp|hut        AERQDLGEAFDGLDSYAEMEAAV--SEAVIDDDEYLESKGVDSDEAADAGRRATEGA---
13414|hp|hma       ANRQGEGDAFAELDSYAEMERQV--DDAGVDDETYLEDSGVDTDAVSAAADRAEQGA---
642|hp|hhi         ANRQGEGDAFAELDSYAEMERQV--DGAGVDDETYLEDSGVDTDAVSAAADRAEQGA---
                   *.. . .  *                   :.*  :*.  *::.  .  *.          

3214|hp|hwa        ---QSRPEIIRSAISSQDAPTEEDIISYATDRGVPTDAARELLEKLIRQGNLTESHGTYR
2306|hp|hla        SDSRSRSEIVRDAVATVDEPTEENVVAHASDHGVPAETAREILTRLARRGELSESGGRYR
9950|hp|hbo        TSSSNRLDVVREALRKEDRPTEEEVVAYAEEHGVPGEAARNVLEKLTRRGEVSESRGRYR
2584|gene|hvo      SGSPDRLTVVREAIRDGDRPTEEEIVAAAVERGVPADRARDLLDKLRRRGEVSESRGRHR
2428|hp|nph        ---RSRKRILLDGLSELDAPTEAEVVEYATAAGVPEAKAERLLTKLRRAGEVTETDGTLR
1874|chp|nrc1      RRSRSRQDTVRAALRELDEPTEREVAAFAAEHGVGSEYVADALAKLTRAGEVVDAGDGYR
279|chp|hut        GGSTSREEIVRAALVELDDPDEEAIVEYAAERGVPEKYTRRALSSLVRAGDVSENRGTYR
13414|hp|hma       TGGSSRKETVTNALRALDEPTEDDIVGYAEERGVPASYTRKALKKLVRAGEASESRGHYR
642|hp|hhi         TRGSSRKETVTNALRNLDEPTEDDIVAYAEERGVPASYTRKALTKLVRAGKASESRGQYR
                       .*   :  .:   * * *  :   *   **    .   *  * * *.  :  .  *

3214|hp|hwa        LL
2306|hp|hla        AL
9950|hp|hbo        LL
2584|gene|hvo      LV
2428|hp|nph        RL
1874|chp|nrc1      LL
279|chp|hut        LV
13414|hp|hma       LL
642|hp|hhi         LL
                    :